(data stored in ACNUC7421 zone)

EMBL: CP001622.PE340

CP001622.PE340       Location/Qualifiers
FT   CDS_pept        complement(351010..352089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0341"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: rec:RHECIAT_CH0000727
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54652"
FT                   /db_xref="GOA:C6B1D3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D3"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ACS54652.1"
FT                   /translation="MADDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIY
FT                   LVFFLPDSVGRMSETLRDIFEQPDQWKIETGPDVLALFVRLGWASAALVAPAFILFMVF
FT                   GVASSVFQNLPTLVLERIRPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFF
FT                   VLRSEYFGSIDAMFSDPQTILVRLMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELK
FT                   MTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIADVHRATLVIANPTHYAVALRYA
FT                   REENDAPVVLAKGQDLIALKIREIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKA
FT                   VAELIHRVYAADAKNKRVR"
     ttggcagacg atgacaagga cagcaaaaca gaagccccaa ccgcgaaaaa gcaaagcgat        60
     gccgcggaaa agggcaacgt gccgtcttcg cgcgaacttt cgatctttgc gaccatcctc       120
     gcgaccttca tttacctcgt attcttcctt cccgacagcg tcggacgcat gagtgaaacg       180
     ctgcgcgaca tcttcgaaca gcccgaccaa tggaagatcg agacggggcc ggatgtgctg       240
     gcactattcg tgcggctcgg ctgggcaagt gcggcgctgg tggcgcccgc cttcatcctg       300
     ttcatggtgt tcggcgtcgc ctcctccgtc ttccagaatc tgccgacact ggtgctggaa       360
     cgcatccgcc cgcaggcctc gcgtatctcg ccgatcaaag gctggtcacg gctcttcagc       420
     gtgcccggcc tggtcgaatt cggaaagtcg ctgttcaagg tggtcgtcgt cggggtgatc       480
     ctgttctttg tgctcaggag cgaatatttc ggttcgatcg acgcgatgtt ctccgatccg       540
     cagacgattc tggtgcgact gatggcggcg atgcgcaaga tcatcatcgt catgctgatc       600
     gccaccgcga tcgtggcaat cgccgatctt ttctggacgc gccatcactg gttcaccgag       660
     ctgaagatga cgcggcacga ggtgaaggaa gaaaacaagc aggcgcaggg cgaccccttc       720
     gtcaagagcc ggcagcgctc actgatgcgc gaccgcgcgc gccggcgcat gatcgccgac       780
     gtccaccgcg cgacgctggt gatcgctaac ccgacgcact atgcggtggc gctgcgttac       840
     gcgcgtgaag agaacgatgc gccggtggtg ctggccaagg gtcaggacct gattgcgctc       900
     aaaatcaggg agatcgccga gaagaacggc ataccggtgt tcgaggatcc gccccttgcg       960
     cgctccatgt ttgcgcaagt ctcgatcgat agtgtcatcc cgtcagtctt ctataaggcg      1020
     gtagcggagc tcatccaccg ggtctacgct gcggacgcca agaacaaacg ggtaagataa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page