(data stored in ACNUC7421 zone)

EMBL: CP001622.PE341

CP001622.PE341       Location/Qualifiers
FT   CDS_pept        complement(352426..353466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0342"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   rec:RHECIAT_CH0000728 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54653"
FT                   /db_xref="GOA:C6B1D4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D4"
FT                   /inference="protein motif:PFAM:PF01706"
FT                   /protein_id="ACS54653.1"
FT                   /translation="MMDFDDFGGALAGKPLTQAEKAAAVLLAMGKGVAGRLLKYFTQAE
FT                   LQTIISSAQSLRAIPPDELLLLVSEFEDLFTEGAGLMDNAKAIEAILEEGLTPDEVDSL
FT                   LGRRTAFQAYETSIWDRLSEAEPTFVAQFLLREHPQTVAYILSMMPSSFGAKVLLQLPD
FT                   NRRADIMNRTVNMKTVSPKAAQIIENQVMTLLAEVEAERNAAGSTKVADLMNELDKPQV
FT                   DTLLSSLESISRESVNKVRPKIFLFEDLMYMPQRSRVMLLNDISTDVLTVALRGSPPEI
FT                   RESVLSAISPRQRRMIESDLQSGMGGVNPREIAIARRAVAQEAIRLANSGQIELKEKEG
FT                   DASAAA"
     atgatggact ttgacgattt cggcggcgca ttagccggga aaccgttgac ccaggctgaa        60
     aaggcggcgg ctgttcttct cgctatggga aagggagtcg ccggccggct gttgaaatat       120
     ttcacccagg ccgaactgca gaccattatc tcatccgccc agtcgctgcg cgccattccg       180
     ccggacgagc tgctgttgct cgtctccgag ttcgaagacc tcttcaccga gggcgccgga       240
     ctgatggaca atgccaaggc aatcgaagcc attcttgaag aaggcctgac gcccgacgag       300
     gtcgacagcc tgctcggccg ccgcactgca ttccaggcct acgaaacctc gatctgggat       360
     cgcctcagcg aggcggagcc gacattcgtc gcgcagttcc tgctgcgcga gcatccgcag       420
     accgtcgcct atattctttc gatgatgccc tcctccttcg gcgccaaggt gctgctgcag       480
     cttcccgaca accgccgcgc cgacatcatg aacagaacgg tcaatatgaa gaccgtcagc       540
     ccgaaggctg cgcagatcat cgagaaccag gtcatgacgc tgcttgccga agtcgaggca       600
     gagcgcaatg cggccggctc gacgaaggtc gccgatctca tgaacgaact cgacaagccg       660
     caggtcgaca cgctgctcag ctcgctcgaa tcgatcagcc gcgaatcggt caacaaggtt       720
     cgcccgaaga tcttcctgtt cgaggacctc atgtacatgc cgcagcgcag ccgcgtcatg       780
     ctgctcaacg acatctcgac ggatgtgctc accgtcgcgc tacgcgggtc gccccccgag       840
     atccgcgaat cggttctctc cgccatcagc ccacgccagc gccgcatgat cgaatcggat       900
     ctgcagagcg gcatgggcgg cgtcaatccg cgcgagatcg cgattgcccg ccgcgccgtg       960
     gcgcaggaag cgattcgcct ggccaattcc ggccagatcg agctcaagga aaaggaaggc      1020
     gacgcttcgg cggccgccta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page