(data stored in ACNUC7421 zone)

EMBL: CP001622.PE342

CP001622.PE342       Location/Qualifiers
FT   CDS_pept        complement(353495..354079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0343"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   rec:RHECIAT_CH0000729 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54654"
FT                   /db_xref="GOA:C6B1D5"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D5"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ACS54654.1"
FT                   /translation="MATKKTQQNSDLSLDLPGSEADLDQAIDDLRGVLKQDADGDLPQF
FT                   GDDPQSDPFAAGTDLAAFGGEASESPFGGDDFGGDFGGSASSAAGMDFGSSPSFEESPA
FT                   PLGSALNSNFDLIMDIPIDVQIMLGTSRMQVSGLMNLNEGATIALDKKIGEPVEIMVNG
FT                   RRIARGEITVLDNDDTRFGVKLIEVLSTKKA"
     atggctacga agaaaacaca gcagaacagc gacctctccc tggatcttcc gggcagcgaa        60
     gccgatctcg atcaggcgat cgacgatctg cgcggcgtac tgaagcagga tgccgacggc       120
     gacctgccgc agtttggcga cgacccgcag agcgacccct tcgcagcagg aacggacctg       180
     gcggccttcg gcggcgaggc ttcggaaagt cctttcggcg gcgacgattt cggcggcgat       240
     ttcggcggca gtgcgagctc ggctgccggc atggatttcg gcagcagccc ctccttcgag       300
     gagtcaccgg ctccactcgg cagcgctttg aattcgaact tcgacctgat catggacatc       360
     ccgatcgacg tccagatcat gctcggcacc agccgcatgc aggtctccgg cctgatgaac       420
     ctcaatgaag gggcgacgat cgccctcgac aagaaaatcg gcgaaccggt cgagattatg       480
     gtgaacggcc gcaggattgc acgtggcgaa attacggtgc ttgataacga cgacacgcga       540
     ttcggtgtga agctgattga agttttgagt acgaaaaaag cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page