(data stored in ACNUC7421 zone)

EMBL: CP001622.PE343

CP001622.PE343       Location/Qualifiers
FT   CDS_pept        complement(354145..355095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0344"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: rec:RHECIAT_CH0000730 flagellar C-ring motor
FT                   switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54655"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D6"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ACS54655.1"
FT                   /translation="MTMSNASHDKPAMDPALLAKLTGGLGDRGGVAKICSSFGEIYSEF
FT                   FPDVIKSETGLDVTVNYLGCEIGYKNHLIEDLSANVTLVDATLRNWSQNITLACGNGFV
FT                   ITLMEHLLGATADTIEEPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAP
FT                   HALDARARPPEDRPDEFAAAINMSITLAGIVSEFALIVPQTALLKTKVTPPKPKRQATG
FT                   KSPEWTEQLGDQVRRSHVTLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANS
FT                   KELYVCEFGRSGENYMVRVKDTMNSDDELIRHLMN"
     atgactatga gcaatgcttc gcacgacaaa ccggcaatgg atcctgccct tctcgccaag        60
     ctgacaggcg ggctcggcga cagaggcgga gttgccaaga tctgcagttc cttcggggaa       120
     atctacagcg aattctttcc cgacgtcatc aaaagcgaga ccggcctcga cgtgacggtc       180
     aactatctcg gctgcgagat cggctacaag aaccacctga tcgaagatct gagcgcgaac       240
     gtcacgctgg tcgatgcgac gctgcgcaac tggtcgcaga acatcacgct tgcctgcggc       300
     aacggcttcg tcatcacgct gatggagcac ctgctcggcg ccaccgccga tacgatcgag       360
     gaaccggccg accggctgct ttcgatcatc gagctcgatc tggcggtcat ggtcttcgac       420
     aagatcgcca aagtgctgcg ctcggccgtc aacgcgccgg gcggcttcga accgagcctt       480
     tcggccccgc acgcccttga cgcgcgcgcc cggccgccgg aagatcgtcc ggacgaattc       540
     gccgctgcca tcaacatgtc gatcacgctt gccggcatcg tttcggaatt cgccttgatc       600
     gttccgcaga cggcgctgct caagaccaag gtgacgccgc cgaagccgaa acgccaggcc       660
     accggcaagt caccggaatg gactgagcag ctcggcgacc aggtccgccg ctcgcatgtc       720
     acgctcgagg cgaagatcag gctgcaggac ctgacgcttc gcacgatatc gaagctgatg       780
     gtcggcgacg tcattccgtt ccgcgaccac ggcgacgtgc gggtcgaggt cagcgccaac       840
     agcaaggaat tgtatgtgtg cgagttcggg cgttcaggcg aaaattacat ggtccgcgtc       900
     aaggatacga tgaactcgga tgacgaactc atccgtcatt taatgaatta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page