(data stored in ACNUC7421 zone)

EMBL: CP001622.PE344

CP001622.PE344       Location/Qualifiers
FT   CDS_pept        complement(355096..355968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0345"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000731 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54656"
FT                   /db_xref="GOA:C6B1D7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000731"
FT                   /protein_id="ACS54656.1"
FT                   /translation="MNIIIGFIVTCGCIVGSFMAMGGEVDALFQPFEFLIIGGAGLGSF
FT                   IMANPMKVVKDSGKALSEAFRHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNP
FT                   AESTIFQSAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYH
FT                   SIQIMSDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSP
FT                   LVSQIKVVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGENKAA"
     atgaacatca ttatcggatt tatagtgact tgcggctgta tcgtcggcag cttcatggcg        60
     atgggcggcg aagtggacgc gctgttccag cccttcgaat tcctcatcat cggcggcgcc       120
     ggcctcggca gcttcatcat ggcgaacccg atgaaggtgg tgaaggactc aggcaaagcg       180
     ctcagcgaag ccttccggca cgccgtaccg aaggaacgca attatctcga tacgctcggc       240
     gtgctctatt cgctgatgcg cgacctgcgc accaagtcgc gaaacgaaat cgaagcccat       300
     atcgacaatc cggccgaatc gacaatcttc cagtcggctc cgacggttct gaagaacaag       360
     gagctgacgg cgttcatctg cgactacgtg cgcctgatca tcatcggcaa cgcccgcagc       420
     cacgagatcg aggcgctgat ggacgaagag ctcaacacaa tcatgcacga caagatgaag       480
     ccctaccact cgatccagat catgagcgat tccttcccgg cgatcggcat cgtcgcggct       540
     gttctcggcg tcatcaaggc gatggcccat atcaacgatt cacccgaagt gctcggtcat       600
     ctgatcggct cggcactcgt cggcaccttc ctcggcattc tcttgtccta ctgcgtctgc       660
     tcgccgctgg tctcccagat caaggtcgtg cgcaacaagc agcaccgcct ctacgtcatc       720
     gtcaagcaga cgctgcttgc ctatatgaac ggctcggtgc cgcaggtcgc tctcgaatac       780
     ggccgcaaga cgatctcggc ttacgagcgt ccttccatcg acgcggtcga gcaggaaatg       840
     atgaaccctg gtggcgaaaa caaggcggct taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page