(data stored in ACNUC7421 zone)

EMBL: CP001622.PE345

CP001622.PE345       Location/Qualifiers
FT   CDS_pept        356223..356957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0346"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00655
FT                   flagellar basal body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54657"
FT                   /db_xref="GOA:C6B1D8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D8"
FT                   /inference="protein motif:TFAM:TIGR02490"
FT                   /protein_id="ACS54657.1"
FT                   /translation="MQSGLYVSLSSQMALEKRLNTIADNMANVNTTGFRATEVKFDEMV
FT                   AATKNKLNTKVAFVSQGNDYLNEGNGELQHTGNMLDFAIKGDAWFALDTPAGRVLTRDG
FT                   RFTIKDTGELVSIRGYPVLDAGGAPIQLNTKGGEPAVGTDGIIYQADRQVASLGLFEAD
FT                   ISKGYLRYENSGIMTTDQPRAVVDRFNVGVEQGYLENSNVNAMREITQLIEVNRAFESV
FT                   SSLMRDSEDSFKEAVQTLGGSR"
     atgcaatccg gtctttatgt ttctctgtcg tcgcagatgg ctctcgaaaa gcgtctgaac        60
     accatcgcag acaacatggc gaacgtgaac acgacgggtt ttcgcgccac cgaggtgaag       120
     ttcgatgaga tggtggcggc cactaagaac aagctgaaca ccaaggtggc cttcgtttcc       180
     cagggcaacg actacctgaa cgagggaaat ggcgagttgc agcacaccgg caacatgctc       240
     gatttcgcca tcaagggcga tgcctggttt gcgctcgata cgccggccgg ccgcgttctg       300
     acgagggacg gccgcttcac gatcaaggat accggcgaac tcgtctcgat aaggggatat       360
     ccggttcttg acgccggcgg cgcgccgatt cagctcaaca cgaagggtgg cgagccggcc       420
     gtcggtacgg acggcatcat ctatcaggcc gaccgccagg ttgcttcgct cggcctgttc       480
     gaggccgata tcagcaaggg ttacctgcgt tacgaaaaca gcggcatcat gaccaccgac       540
     cagccgcgcg ccgtcgtcga ccgcttcaat gtcggtgtcg agcagggtta tctcgaaaac       600
     tccaacgtca acgccatgcg cgagatcacc cagctgatcg aagtcaaccg cgccttcgaa       660
     agtgtctcgt cgctgatgcg cgacagcgag gattccttca aggaagccgt ccagacactt       720
     gggggcagcc gctaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page