(data stored in ACNUC7421 zone)

EMBL: CP001622.PE346

CP001622.PE346       Location/Qualifiers
FT   CDS_pept        357077..358477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0347"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: ret:RHE_CH00656 flagellum-specific ATP
FT                   synthase; TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54658"
FT                   /db_xref="GOA:C6B1D9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D9"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ACS54658.1"
FT                   /translation="MSTTLLSEDGLSPKLAHLAGLVDRYASPEFAVAHGGRVQTIAAGH
FT                   YTVHGLSRHVRLGEFVAHKSATGIHLGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGA
FT                   FRIAPTDSWCGRTVNSLCEPIDGLGPIAEGLDRRSISNTAPPSMTRKRVETGFKTGVRA
FT                   IDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GSNMKKAIAVVATSDESPMLRKMAPLTAVTIAEHFRDKGENVLFIIDSVTRFAHAIREV
FT                   ATASGEPPIARGYPASVFTELPRLLERAGPGPEGAGTITAIISILVDGDNHNDPIADST
FT                   RGILDGHIVLQRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVSRLKVLIHRFEETR
FT                   DLRMIGGYRQGADPDLDMAIKQVPIIYDVLKQSPGDRDSLDAFADLAGALKAAAGMGNQ
FT                   GAPIQRRG"
     atgagcacca cgctactgtc cgaagacggc ctttccccga agctggcgca tctggcgggc        60
     ctcgtcgacc gatacgcatc gccggagttt gcggttgccc atggcggtcg cgtgcagacc       120
     atcgccgccg gccactacac ggttcacggt ctctcccgtc acgttcgtct cggcgagttc       180
     gtggcccata aatcggcgac cggcatccat ctcggcgaag tcgtgcgcgt cgagccggaa       240
     ctgatctatg tctgcccgat cgaacccggc gagccgatcg gcatccacga taccgtcatc       300
     cgcaagggcg ccttccgcat tgcaccgacg gacagctggt gcgggcgcac cgtcaactcg       360
     ctctgcgagc cgatcgacgg gctgggcccg atcgccgagg gcctcgatcg ccgctcgatc       420
     tccaataccg cgccgccctc gatgacccgc aagcgtgtcg agaccggctt caagaccggc       480
     gtacgcgcga tcgacatctt ctcgccgctc tgcctcggcc agcgcctcgg catcttcgcc       540
     ggctccggcg tcggcaagtc aacgcttctt tccatgctcg cccgcgccga tgctttcgac       600
     aaggttgtca ttgcgcttgt cggcgaacgc ggccgcgagg tgcgcgaatt catcgaggat       660
     acgctcggca gcaatatgaa gaaggcgatc gccgtcgtcg ccaccagcga cgagagcccg       720
     atgctgcgca agatggcgcc gctgacggcg gtcactatcg ccgagcattt ccgcgacaag       780
     ggcgagaacg tcctcttcat catcgacagc gtcacgcgtt tcgcccatgc gatccgcgag       840
     gtggcgaccg cctccggcga gccgccgatc gcgcgcggtt atcccgcctc cgtcttcacc       900
     gagctgccgc gcctcctgga acgcgccggt cccggtcccg agggcgccgg caccatcacc       960
     gcgatcatct cgatccttgt cgacggcgac aatcacaatg acccgatcgc cgattcgacc      1020
     cgcggcatcc tcgacggaca tatcgtcctg cagcgcagtc tcgccgaaga agggcgttat      1080
     cccccgatcg atccgctcgc ctcgatctcg cgtcttgccc gcaaggcctg gacgccggat      1140
     caggaaaagc tggtatcgcg gctgaaggtg ctgatccacc gtttcgaaga gacgcgcgat      1200
     ctgcgcatga tcggcggtta ccgtcagggt gctgatcccg atctcgacat ggcgatcaag      1260
     caggtgccga tcatttacga cgtcctgaag cagtctccgg gcgaccgcga ctcgctcgac      1320
     gctttcgccg atctcgccgg tgcgctcaag gctgcagccg gcatgggcaa tcagggcgcc      1380
     cctattcaga ggagaggcta g                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page