(data stored in ACNUC7421 zone)

EMBL: CP001622.PE347

CP001622.PE347       Location/Qualifiers
FT   CDS_pept        358480..359022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54659"
FT                   /db_xref="GOA:C6B1E0"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00657"
FT                   /protein_id="ACS54659.1"
FT                   /translation="MADFDDERIASLKQRRKAAILDRFLTFAGLALAGASAFFPWYVFF
FT                   NADKFGINVASSSNSRELPDWPARNVFSVSPLAMVNKNEADKKAPPIDPLTTATVSDLG
FT                   KERDGRAIQEDQPFPGKSSFRLLHVSNGRALIEDPSGMYVVRIGSILPDESRLATLEQR
FT                   DGKWVIVTSKGETYQNN"
     gtggctgatt tcgacgacga acgcattgct tccctgaagc agcgcaggaa agccgccatc        60
     ctggatcggt ttctgacctt cgccggcctg gcgcttgccg gcgcctccgc cttctttccc       120
     tggtacgtct tcttcaacgc ggacaagttc ggcatcaatg tcgccagcag cagcaattcg       180
     cgcgaactgc cggactggcc ggcccgcaac gtcttcagcg tctcgccgct tgccatggtc       240
     aacaagaacg aagcggacaa gaaggccccg ccgatcgatc cgctgacgac ggcgacggtc       300
     tccgatctcg gcaaggagcg cgatggccgc gctatacagg aggatcagcc cttccccggc       360
     aaatcgtcct tccggctgtt gcatgtttcc aacggccggg cgctgatcga ggatccctcc       420
     ggcatgtatg tggtgcgcat cggctcgatc ctgcccgatg aaagccgcct tgcgacactc       480
     gagcagcgcg acggcaaatg ggtgatcgtc acctccaagg gcgagaccta ccagaacaat       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page