(data stored in ACNUC7421 zone)

EMBL: CP001622.PE348

CP001622.PE348       Location/Qualifiers
FT   CDS_pept        359289..359681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0349"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /note="KEGG: ret:RHE_CH00658 flagellar basal body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54660"
FT                   /db_xref="GOA:C6B1E1"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00658"
FT                   /protein_id="ACS54660.1"
FT                   /translation="MQPIQLFDLASRQAEWLTIRQQVVAGNIANANTPKFHAKDVTPFD
FT                   AVLDNSNINMARTNPAHLSGNDFSDSGDIDVKDAALDQEIGVQESGNTVGLAEELSKSG
FT                   DIKRQYDLNTSLVSSFNRMMLMTVRK"
     atgcaaccga tccaactttt cgacttggct tcgcggcagg cggaatggct gacgattcgt        60
     cagcaggttg ttgccggcaa catcgcgaat gccaataccc cgaagttcca cgccaaggac       120
     gttacgccct ttgatgcggt gctcgacaat tccaatatca acatggcgcg caccaatccg       180
     gcgcatctca gcggcaacga tttcagcgac agcggcgata tcgacgtcaa ggatgccgcg       240
     ctcgaccagg aaatcggtgt ccaggaatcc ggcaatacgg tcggtttggc cgaggagctc       300
     tccaagtcgg gcgatatcaa gcgtcagtac gatctgaaca cctcgctggt cagttccttc       360
     aaccgcatga tgttgatgac cgtcaggaag taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page