(data stored in ACNUC7421 zone)

EMBL: CP001622.PE349

CP001622.PE349       Location/Qualifiers
FT   CDS_pept        359686..360102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0350"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00659
FT                   flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54661"
FT                   /db_xref="GOA:C6B1E2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E2"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ACS54661.1"
FT                   /translation="MDPLSAAMKIAGSGLEAQSTRLRIVSENIANARSTGDTPGADPYR
FT                   RKTITFGQQMDRTNGVETVGVKKVGVDEGDFSTEFDPSNPAADPKGVVKLPNVNILVEM
FT                   ADMREANRSYDANLQTIKQTRDLISSTIDLLKSQ"
     atggatccgc tttcagcagc aatgaaaatc gccggttccg ggctcgaggc gcagtcgacg        60
     cggctgcgca tcgtctcgga aaacatcgcc aatgcccgct cgacgggtga cacgcccggt       120
     gccgatccct atcgccgcaa gacgatcacc ttcggccagc agatggatcg caccaacggt       180
     gtcgagactg tcggcgtcaa aaaggtcggc gtcgacgaag gcgacttcag cactgaattc       240
     gaccccagca atccggctgc ggacccgaag ggcgtcgtca aactgccgaa cgtcaatatc       300
     ctggttgaga tggccgacat gcgcgaagcc aaccgctcgt atgacgccaa tctgcagacc       360
     atcaaacaga cccgcgatct catctcctcc acgatcgacc tcctgaagag ccaataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page