(data stored in ACNUC7421 zone)

EMBL: CP001622.PE35

CP001622.PE35        Location/Qualifiers
FT   CDS_pept        complement(32816..33382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0036"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: Scaffold protein Nfu/NifU; nitrogen-fixing
FT                   NifU domain protein; KEGG: rec:RHECIAT_CH0000421 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54347"
FT                   /db_xref="GOA:C6AYC3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC3"
FT                   /inference="protein motif:PFAM:PF08712"
FT                   /protein_id="ACS54347.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARL
FT                   FEISGVTGVYFGYDFISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA
FT                   GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
     atgttcattc agaccgaagc cacgccgaat cccgccacgc agaagttcct gccgggcaag        60
     gtggtgatgg aaaacggcac ggccgagttc cgcagcactg aggaggctca ggcctcgccg       120
     ctcgctgccc gcctgttcga aatatcaggc gtcaccggcg tctatttcgg ctatgatttc       180
     atttccgtct ccaaggataa tgccgactgg caacatctta agccggctat attaggctcg       240
     atcatggagc acttcatgtc cggcaagccg gtcatgggcg atgcctccat cctttccgaa       300
     gacgccgatg ccggcgacga attctttgac gaaggcgatg aatcgatcgt gctgaccatc       360
     aaggagctac tggaaacccg cgtgcgccca gccgttgccc aggacggcgg cgacatcacc       420
     ttccgcggct tcaaggacgg caaggtctat ctgaacatga agggttcctg cgccggctgc       480
     ccgtcttcga cggcaacgct gaagcacggc gtgcagaacc tgctgcggca tttcgttccg       540
     gaagtgcagg aagtgattgc cgcttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page