(data stored in ACNUC7421 zone)

EMBL: CP001622.PE350

CP001622.PE350       Location/Qualifiers
FT   CDS_pept        360105..360446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0351"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: rec:RHECIAT_CH0000737 flagellar hook-basal body
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54662"
FT                   /db_xref="GOA:C6B1E3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E3"
FT                   /inference="protein motif:PFAM:PF02049"
FT                   /protein_id="ACS54662.1"
FT                   /translation="MISSVQNVSNLSMTRALGAVDTENSTSSSAATMPGAAGAANGMSF
FT                   ASVMGNMASDAVSSLKGAESMSFAGIKGTATTREVVDSMLQAEQTLQTAIAIRDKVVSA
FT                   FLEVTKMQM"
     atgatcagca gcgtccagaa cgtcagcaac ctttcgatga cccgtgcgct cggcgccgtc        60
     gacaccgaaa attccacctc gtcgtctgcc gccaccatgc cgggcgccgc aggtgcggcc       120
     aacggcatga gcttcgcctc cgtcatgggt aacatggcga gcgacgcggt cagcagcctg       180
     aagggtgcgg aaagcatgtc ctttgccggt atcaagggca cggcgacgac gcgcgaagtc       240
     gtcgattcca tgctccaggc cgagcagacg ctgcagaccg cgattgccat ccgcgacaag       300
     gtcgtctcgg cctttctcga agtcaccaag atgcagatgt aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page