(data stored in ACNUC7421 zone)

EMBL: CP001622.PE352

CP001622.PE352       Location/Qualifiers
FT   CDS_pept        361271..361753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0353"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="TIGRFAM: flagella basal body P-ring formation
FT                   protein FlgA; KEGG: ret:RHE_CH00662 flagellar basal body
FT                   P-ring biosynthesis protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54664"
FT                   /db_xref="GOA:C6B1E5"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E5"
FT                   /inference="protein motif:TFAM:TIGR03170"
FT                   /protein_id="ACS54664.1"
FT                   /translation="MMFCRAGHISGWVAAATIAVAGIFLPADVDAGMGYAVVPTTIIYP
FT                   GDTLSSSQLQEVEVTNPNLAGDYAKSISQVEGMVSKRTLLPGRTISVSGLREAYTVTRG
FT                   SSIRLVLSFGALTISAAGTPLEDGTTGQVVRARNMDSGVIVSGTVLADGTVHVRAK"
     atgatgtttt gccgggcagg acacatctca ggatgggtgg cagcagccac gatcgcagtc        60
     gcgggcattt tcttgcccgc ggacgtggat gccggcatgg gttatgccgt cgttccgacg       120
     acgatcatct atcccggcga cacattgtcg tccagccagc ttcaggaggt cgaggttacc       180
     aaccccaacc tcgccggcga ctatgccaaa tccatttccc aggtcgaagg catggtctcc       240
     aagcgtacgc tgttgccggg ccggacgatt tcggtttcgg gcctgcgcga ggcctatacg       300
     gtgacgcgcg gctcttcgat ccgtctggtt ctgtcgttcg gcgcgctgac gatttccgcc       360
     gccggcacgc cgctcgaaga cggcacgacc gggcaggtcg tccgcgcgcg caatatggac       420
     tccggcgtca tcgtcagcgg cacggtgctt gcggacggca cggtccatgt gagggcaaaa       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page