(data stored in ACNUC7421 zone)

EMBL: CP001622.PE353

CP001622.PE353       Location/Qualifiers
FT   CDS_pept        361750..362871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0354"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000740 flagellar basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54665"
FT                   /db_xref="GOA:C6B1E6"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E6"
FT                   /inference="protein motif:PFAM:PF02119"
FT                   /protein_id="ACS54665.1"
FT                   /translation="MKLFFRFVTLVAVLAMSLADVVPAWALTSRIKDIASLQAGRDNQL
FT                   IGYGLIVGLQGTGDGFRSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPF
FT                   ASPGSRIDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQGAAIVSGFQAQGQAATV
FT                   TEGVTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGG
FT                   PVAEAKDSQEVVIQKPRTADLTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVS
FT                   PVAVSYGTLTVQVTETPQIIQPEPFSQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLV
FT                   AGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ"
     atgaaattgt tcttccgctt cgtcaccctt gtcgcggttc tcgccatgag tttggctgat        60
     gtcgtgcccg cctgggcgct gacttcccgc atcaaggaca tcgcttccct tcaggccggc       120
     cgcgacaacc agctgatcgg ttatggcctc atcgtcggcc tccaggggac cggcgacggc       180
     ttccggtcct cgcccttcac cgagcagtcg atgcgcgcga tgctgcagaa tctcggcatc       240
     tcgacgcagg gcggccagtc caacgccaag aacacggcgg ccgtgatggt caccgccaac       300
     ctgccaccct tcgcaagccc cggcagccgc atcgacgtga cggtgagctc gctcggcgat       360
     gcgacgtcgc tgcgcggcgg cacgctcgtc atgacctcgc tttctggcgc cgacggccaa       420
     atctatgccg tcgcgcaggg tgccgccatc gtttccggtt ttcaggcgca gggccaggcg       480
     gcgaccgtga ccgaaggtgt caccaccgcc ggccgcgtgc ccggcggcgc gatcatcgaa       540
     cgtgaactgc cgtcccgctt caaggactcg gtcaatctcg tcctgcagct gcgcaacccc       600
     gacttctcga cggcgatccg catcgccgac atcgtcaacg gttatgcctc ggcgcgcttc       660
     ggcgggccgg tcgccgaagc caaggattcg caggaagtcg tgatccagaa gccgcgcaca       720
     gccgatctca cccggctgat ggccgatatt gaaaatctca tcgtcgagac cgacacgccg       780
     gccaaggtgg tcatcaacga acgcaccgga acgatcgtca tcgggtccga cgtccgcgtc       840
     tcgccggtcg ccgtcagcta cggcaccttg accgtccagg tcaccgagac gccgcagatc       900
     atccagcccg aacccttctc gcaaggccgg accgccgtcc agccgcagac cgatattgcg       960
     gccgagcaga ccggcgggcg cgtcgccatc atcgatggtc cggatctcag gacccttgtc      1020
     gccggtctca acaatatcgg cgtgaaaccg gatggcatca tcgccattct ccagggcatc      1080
     aagtcggcgg gcgccctgca ggcggagctt gtgctgcaat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page