(data stored in ACNUC7421 zone)

EMBL: CP001622.PE354

CP001622.PE354       Location/Qualifiers
FT   CDS_pept        362868..363410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0355"
FT                   /product="putative exported flagella related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000741 putative exported
FT                   flagella related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54666"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000741"
FT                   /protein_id="ACS54666.1"
FT                   /translation="MIDIINPDMTVLQLLRRLALPAAGLVLLSIPSAFAQEHAPAGDIT
FT                   SQDEIKQFCTNIAEPARDQRYLLQKQELEKLRADIDARMAEMDKRKAEYQDWLKRRDDF
FT                   LKQAEAGLTEIYRKMKPDAAALQLQDMKIEVASAVIMRLGPRQSSLILNEMDPEKAAVI
FT                   ASVIASASDPNTSKDPS"
     atgattgata tcatcaaccc tgacatgacg gttttgcaat tgctgcgccg gctggcgctg        60
     cccgccgcag gcctcgtcct tctgtcgatc cccagtgcct tcgcgcagga acatgcgccg       120
     gccggcgaca tcacgtccca ggacgagatc aagcagttct gcaccaacat cgccgagccc       180
     gcccgcgacc agcgttacct cctgcagaag caggaactgg aaaagcttcg cgccgacatt       240
     gacgcccgca tggcggaaat ggacaagcgc aaggccgagt accaggactg gctgaagcgg       300
     cgcgacgatt tcctgaagca ggcggaggcc ggcctcaccg aaatctacag gaagatgaag       360
     ccggatgcgg ccgcactcca gctgcaggac atgaagatcg aggtggcctc cgccgtgatc       420
     atgcggctcg ggccgcgtca gtcgagcctc atcctcaacg agatggaccc tgagaaggcc       480
     gcggtcatcg ccagcgtcat cgccagtgcg tccgatccca atacgtcgaa ggatccttca       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page