(data stored in ACNUC7421 zone)

EMBL: CP001622.PE355

CP001622.PE355       Location/Qualifiers
FT   CDS_pept        363407..364123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0356"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000742 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54667"
FT                   /db_xref="GOA:C6B1E8"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E8"
FT                   /inference="protein motif:PFAM:PF02107"
FT                   /protein_id="ACS54667.1"
FT                   /translation="MNMRFPAAIAALALLAGCQSPTAVSEIGRAPAMSPIGSGLAYGQT
FT                   PQMALYPKQPRAVAQGYSLWSDSQAALFKDARALNVGDILTVDIQINDKGSFDNETNRS
FT                   RKNSSGMNWDVNAQIFGWTPESKTDLTYGSDTSTDGKGKIERTDKLTLLVAAVVTGILE
FT                   NGNLVISGSQEVRLNQELRILNVAGIVRPQDVNAENQISYDKIAEARISYGGRGRLMEV
FT                   QQPPRGQQAVDLFSPL"
     atgaatatgc gtttcccggc cgcgatcgcc gccctcgcac tccttgcagg ttgccagtct        60
     ccgacggcgg tcagcgagat cggccgtgcg cctgccatga gcccgatcgg cagcggcctt       120
     gcctacgggc agacgccgca gatggcgctt tatccgaagc agccgcgcgc cgtggcgcag       180
     ggctattcgc tgtggagcga ttcgcaggcc gccctcttca aggatgcgcg cgcgctgaac       240
     gtcggcgaca tcctgaccgt cgacatccag atcaacgaca agggctcctt cgacaacgag       300
     accaaccgca gccggaagaa ttcgagcggc atgaactggg acgtcaacgc ccagatcttc       360
     ggctggacgc ccgagtccaa gaccgacctc acctatggtt ccgacaccag caccgacggc       420
     aagggcaaga tcgagcgcac cgacaagctc acccttctgg tcgccgccgt cgtcaccggc       480
     attctcgaaa acggaaacct tgtcatatca ggctcgcagg aagtccgcct gaaccaggaa       540
     ctgcgcatcc tgaacgttgc cggtatcgtt cgtccgcagg acgtcaatgc cgaaaaccag       600
     atctcctacg acaagatcgc cgaagcccgc atctcctacg gcggccgcgg ccgtctgatg       660
     gaagtgcagc agcctccgcg cggccagcag gccgtcgatc ttttctcgcc gctttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page