(data stored in ACNUC7421 zone)

EMBL: CP001622.PE356

CP001622.PE356       Location/Qualifiers
FT   CDS_pept        364136..364642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0357"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: ret:RHE_CH00666 flagellar biosynthesis transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54668"
FT                   /db_xref="GOA:C6B1E9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E9"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ACS54668.1"
FT                   /translation="MAEPDASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPN
FT                   IKGAKEVEQAKDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLF
FT                   NGPPDVKVSEDIHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFR
FT                   TFVIE"
     atggcagagc cagacgcaag cgcaggtcaa tcgcagaaga aatccggcgc gctgatgacg        60
     atcatcggca tcgccgtcct gaccctgctc ggcgccggcg gcggctgggc ggtcggcacg       120
     atcgtcgcgc ccaacatcaa gggcgccaag gaggtcgagc aggccaagga tgctgaggcc       180
     aagaagaagg ccgaggaagg cctggcgcgc atctcgaccg aggccaacaa cgtcgtccag       240
     ctcgagccga tcacctcgaa cctcgcctac ccctcagaaa actgggtgcg actcgaagtc       300
     gcgctgctgt tcaacgggcc gccggatgtc aaggtttccg aggatattca ccaggatatc       360
     ctcgcctata tcaggaccgt ttccctccag cagatcgagg ggccgcgcgg ctttcaatat       420
     ctcaaggatg acatacagga acgtgttgac cttcgctcgc aagggcgggt atcgaaggtc       480
     atgttcagga catttgtcat cgaatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page