(data stored in ACNUC7421 zone)

EMBL: CP001622.PE357

CP001622.PE357       Location/Qualifiers
FT   CDS_pept        364639..365376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0358"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   ret:RHE_CH00667 flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54669"
FT                   /db_xref="GOA:C6B1F0"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F0"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ACS54669.1"
FT                   /translation="MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFG
FT                   LLTILSVAPGILIMVTSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTF
FT                   DQAWQNGVQPLLANQINETEAVQRIAEPFRTFMAANTRDKDLALFVDLARERGQNIQTT
FT                   DPIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFS"
     atgattcgtc tcatagtttt ccttgccgcc atgatggcgg taccggaact ggcggtggca        60
     cagcagctgc cgactgactt gttgaacgtg ccggtcgatg gctccgtcgc cgcctggatc       120
     atccgcacat tcggcctgct gaccattctt tcggtcgctc cgggcatcct gattatggtg       180
     acgagctttc cgcgcttcat catcgccttc tcgatcctgc gctcggggat gggcctctcc       240
     tcgacgccct ccaacatgat cctcttgtcg ctgtcgctgt tcatgacctt ctacgtcatg       300
     tcgccgacct tcgatcaggc ctggcagaac ggcgtgcagc cgctgcttgc caatcagatc       360
     aacgagaccg aagcggtcca gcgtatcgcc gaacccttcc gcaccttcat ggcggccaat       420
     acccgcgaca aggatctggc gctcttcgtc gatctggcgc gcgaacgcgg acagaatatc       480
     cagacgaccg atccgatcga ctaccgcgtg ctgatcccgg ccttcatgat ttccgaaatt       540
     cgccgcggct tcgagatcgg cttcctcgtc gtgctgccgt tcctcgtcat cgacctcatc       600
     gtcgcgacca tcaccatggc gatgggcatg atgatgctgc cgccgacctc gatctcgctg       660
     cctttcaaga ttctcttctt cgtgctgatc gacggctgga acctgctcgt cggcagcctg       720
     gtgcgctcgt tcagctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page