(data stored in ACNUC7421 zone)

EMBL: CP001622.PE358

CP001622.PE358       Location/Qualifiers
FT   CDS_pept        complement(365518..367491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54670"
FT                   /db_xref="GOA:C6B1F1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000745"
FT                   /protein_id="ACS54670.1"
FT                   /translation="MRASAIDSHARTFPSRSWVLNSKVSFSAASKDYQMGRYTQSLATL
FT                   NQLMDIQQDAKTYALLAKNLVQLGFKADAAKAYGLAGNCEGPNSYEYQKQAAKLHYETG
FT                   NEDDALLIAMRNLTKAQEDAELAFIITAIYLKRQQRDIIRPFKTVLSQSANPDHMRLAA
FT                   LLLSDDLNDATNQNLARNIFKRFPGNLAFRFLHLVFAREFNEFEEASKHQAVIDAALAK
FT                   GDIEILRKDNPFYHLHWCGNEDFNRYATIGTTPLNQERVAFRRNQPHTWSDKIRIGYMS
FT                   SDFWDRHATMKLLQRILELHDTDRFEVTLFCHTGPEYLKHNTIDRSRWGRIVTVHGFSD
FT                   QAVLEAVREHNIDIMVDLKGHTSGSRATAFNLPLAPVHVGWLGFPGSTVNVDLDYVIGD
FT                   HFVLPEVAKPFYHEKFCRLPESYQPNDPMHRPKPRPVTREQLGLPDDAFIFASFNGNRK
FT                   ITPETIDSWCRILKRAPNSVLWLMANTPRNQANLLKQFQTAGISAKRIIFCPRAPYEQH
FT                   IDRQQAADIGIDTFPVNGHTTTSEQLWGGLPVLTVKGTNFASRVSESLLRAIDLPELVA
FT                   PDLRAYEDMAVELAENPGRIAEYKAHLKEKRYTAPLFDAERFCDHLEQAYQIMAERAKQ
FT                   GLAPDHMDIPALPPRTAPFAAE"
     atgcgcgctt cggcgatcga cagccatgcc agaacatttc cttcacggag ttgggttttg        60
     aacagcaaag tttcgttctc tgcggcatcc aaggattacc agatgggccg ctacacacag       120
     tccttggcga cgctcaacca gttgatggat atccagcagg acgccaagac ctatgcgctg       180
     ctggccaaga acctcgtgca gctcggcttc aaggccgatg ccgcgaaagc ctatggcctg       240
     gccgggaatt gcgaaggacc gaattcctac gaataccaga aacaggctgc caagctgcat       300
     tacgagaccg gcaacgagga cgatgctctg ctgatcgcca tgcgaaacct caccaaggcg       360
     caggaagacg cggaactcgc cttcatcatc accgcgatct atctgaagcg ccagcagcgg       420
     gatatcatcc gcccgttcaa gacggtgctg tcgcagagtg ccaatcccga tcatatgcgc       480
     ctggcggccc tgctgctgag cgacgatctg aacgacgcaa ccaaccagaa cctcgcgcgc       540
     aacatcttca agcgttttcc tggcaacctc gcatttcgct tccttcacct tgttttcgcc       600
     cgcgaattca atgagttcga agaggcgagc aagcatcagg cggtaatcga cgcggccctt       660
     gcaaagggcg atatcgagat cctgcgcaag gacaacccgt tctatcatct gcactggtgc       720
     ggcaacgaag acttcaaccg gtatgcgacg atcggcacca cccccctcaa ccaggaacgg       780
     gtggccttcc gccgcaatca accgcacaca tggtcggaca agatccgcat cggctacatg       840
     tcatcagact tctgggatcg ccatgcgacg atgaagctct tgcagcgcat cctggaactg       900
     cacgacacgg accggttcga ggtgacgctc ttctgccata cgggcccgga atacctcaag       960
     cacaacacga tcgaccgcag ccgctggggc cggatcgtca ccgttcacgg cttctccgat      1020
     caagcggtgc tggaagcggt gcgcgagcat aatatcgaca tcatggtcga cctgaagggc      1080
     cacacttcgg gcagtcgcgc gacggccttc aacctgccgc tcgcaccggt gcatgtcggc      1140
     tggctcggtt tccccggcag cacggtcaat gtcgatctcg attacgtcat cggcgaccat      1200
     ttcgtcctgc ccgaggtggc caagcccttc taccacgaga agttctgccg cctgccggag      1260
     agctaccagc cgaacgaccc gatgcatcgt ccgaagccgc gtcctgtcac ccgcgagcaa      1320
     ctcggcctgc ctgatgacgc cttcatcttc gcgtccttca acggtaaccg caagatcacg      1380
     ccggagacga tcgacagctg gtgccgcatt ctcaagcgcg caccgaacag cgtgctctgg      1440
     ctgatggcga atacgccgcg caaccaggca aacctcctga agcaattcca gacggcgggc      1500
     atttccgcca agcggatcat cttctgcccc cgcgcgccct atgaacagca catcgaccgc      1560
     cagcaggcgg ccgatatcgg catcgatacc ttccccgtca atggccacac gaccacctcg      1620
     gagcagctct ggggcggcct gccggtcctg accgtcaagg gcaccaactt cgcctcacgc      1680
     gtcagcgaga gcctgctcag ggccatcgac ctgcctgagc tcgtcgcgcc cgacctgcgg      1740
     gcctatgagg atatggctgt cgaactggct gagaatcccg gacggatcgc tgagtacaag      1800
     gcgcatctca aggagaagcg ctataccgcg ccgctcttcg acgcagaacg gttctgcgac      1860
     catctggagc aggcctatca aatcatggcc gagcgcgcca agcagggtct tgcccccgat      1920
     cacatggaca ttccggcgtt gccgccgcgc acggcgccgt tcgcggccga atga            1974
//

If you have problems or comments...

PBIL Back to PBIL home page