(data stored in ACNUC7421 zone)

EMBL: CP001622.PE359

CP001622.PE359       Location/Qualifiers
FT   CDS_pept        367922..368827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00669 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54671"
FT                   /db_xref="GOA:C6B1F2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F2"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54671.1"
FT                   /translation="MTSINTNSSAQAALQTLRSVNQNLNNTQNHVSSGYRVEKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGVGAAKVDTAYTAMDSAIDVVGDIKAKLVAATENGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFNGENWVAGADGTKSVVSSFVRDGSNAVSITTTDYV
FT                   LDSGSAGNVLFGMSGGSVETSTGILGTSSGATGSIYAMDITSFTAGQIQSALTNVEAAL
FT                   KSMTSAGAALGSLSSRIDAQDDFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AIQSLSIANSSSQNILSLFR"
     atgacaagca ttaacacgaa ttcttccgca caggccgctc tccagacgct gcgcagcgtc        60
     aaccagaacc tgaacaacac gcagaaccac gtttcttctg gttaccgtgt tgaaaaggct       120
     tcggacaacg ctgcttactg gtcgatcgca acgaccatgc gttctgataa caaggctctc       180
     tcggccgtct ccgacgctct cggcgtaggc gccgccaagg tcgacactgc ttacaccgcc       240
     atggacagcg ccatcgacgt cgtcggcgac atcaaggcga agctcgttgc cgccactgaa       300
     aacggcgtcg acaaggccaa ggtccaggaa gaaatcggtc agctgcagca gcagctcctg       360
     agcatcgctc agtcggcttc cttcaatgga gaaaactggg ttgccggcgc tgacggcacc       420
     aagagcgtcg tctcctcgtt cgtccgtgac ggctccaacg ccgtttcgat caccacgacc       480
     gactatgttc tcgacagcgg ctctgcaggc aacgttctgt tcggcatgag cggcggctcg       540
     gtcgaaacct ccacgggtat cctcggtact tcgagcggtg cgaccggttc gatctacgcg       600
     atggacatca ccagcttcac cgccggccag atccagtcgg ctctgaccaa cgttgaagca       660
     gctctgaagt ccatgaccag cgcaggcgct gctctcggct cgctctccag ccgcatcgac       720
     gcccaggacg acttcgtctc ggctctgagc gactcgatcg actccggtgt cggccgtctc       780
     gtcgatgcca acatggaaga agagtcctcc aagctcagcg ccctgcagac ccagcagcag       840
     ctggcgatcc agtcgctgtc gatcgcgaac tcctcttcgc agaacatcct gtcgctcttc       900
     cgctaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page