(data stored in ACNUC7421 zone)

EMBL: CP001622.PE36

CP001622.PE36        Location/Qualifiers
FT   CDS_pept        complement(33593..34084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0037"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ret:RHE_CH00382
FT                   putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54348"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACS54348.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPDGDFQQWLGVEEIMRAEAREEAEAVVAKIAQIVRETIGIEPEVVIREGGAAEQ
FT                   INAVIEEDRDVAILVLAAGSAKEGPGPLVSSVAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
     atggtatcga agcgactctc acggctcgaa ggtcaccgcc gcaaattcat ggcagtgatc        60
     gacggcacac ccgaatgcca acgcgccgtt cattatgccg gccggcgcgc gaagaattcc       120
     aatggcgggc tagtgctgct ctacgtgatc cccgatgggg atttccagca atggctcggc       180
     gtcgaagaga tcatgcgggc cgaagcgcgc gaggaagccg aggcggtggt tgccaagatc       240
     gcccagatcg tgcgcgagac catcggcatc gagcctgaag tcgtcatccg cgagggcggt       300
     gctgccgaac agatcaatgc cgtgatcgag gaagaccgcg atgtagcgat cctggttctg       360
     gccgccggtt cggcgaagga aggtccaggg ccgctggtct cctcggttgc cggccgcgcc       420
     gcggcgtttc cgatcccggt taccgtgctg ccggatacgc tgaccaacga ggaaatcgac       480
     gccctctgtt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page