(data stored in ACNUC7421 zone)

EMBL: CP001622.PE360

CP001622.PE360       Location/Qualifiers
FT   CDS_pept        369110..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0361"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000748 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54672"
FT                   /db_xref="GOA:C6B1F3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F3"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54672.1"
FT                   /translation="MTSINTNNAAMAALQTLRGINQGLQETQAHVSSGYRVGKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVVGDIKAKLVAATESGVD
FT                   KAKVQEEISQLQQQLLSVAQSASFSGENWVAGADGTKNVVASFVRDGSNAVSVVMTDYV
FT                   LDSSSMGNVLFGMSVGSVETSTGILGTSNGATGSVYAMDITNFTLGEIQSALTNVESAL
FT                   KAMTSAGAQLGSISKRIELQENFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AVQSLSIANSSSQTILTLFRG"
     atgacgagca tcaacaccaa taacgctgca atggcagccc tccagactct ccgtggcatc        60
     aaccagggtc tccaggaaac ccaggcccac gtttcgtccg gctatcgcgt cggcaaggct       120
     tcggacaacg ctgcttactg gtcgatcgca acgaccatgc gttctgataa caaggctctc       180
     tcggctgtct ccgacgctct cggcctcggc gctgcaaagg tcgacaccgc ttactctgct       240
     atggacagcg ccatcgacgt cgtcggcgac atcaaggcca agctggttgc cgccactgaa       300
     agcggcgtcg acaaggccaa ggtccaggaa gaaatcagcc agctgcagca gcagctcctg       360
     agcgtcgctc agtcggcttc cttctccggt gaaaactggg ttgctggcgc tgacggcacc       420
     aagaacgtcg ttgcctcctt cgtccgtgac ggctccaacg ccgtttcggt cgtgatgacc       480
     gactatgttc tcgacagctc ctccatgggc aacgttctgt ttggcatgag cgtcggctcg       540
     gtcgaaacct ccacgggtat cctcggtact tcgaatggtg cgaccggttc tgtctacgca       600
     atggatatca ccaacttcac cctcggcgaa atccagtcgg ctctgactaa cgttgaatcg       660
     gctctgaagg cgatgaccag cgccggcgct cagctcggct cgatctccaa gcgcatcgaa       720
     ctgcaggaaa acttcgtgtc cgctctcagc gactcgatcg actccggtgt cggccgtctc       780
     gtcgacgcca acatggaaga agagtcctcc aagctcagcg ccctgcagac ccagcagcag       840
     ctggccgtcc agtcgctgtc gatcgcgaac tcctcttcgc agaccatcct cacgctgttc       900
     cgcggctaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page