(data stored in ACNUC7421 zone)

EMBL: CP001622.PE361

CP001622.PE361       Location/Qualifiers
FT   CDS_pept        370266..371177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0362"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00671 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54673"
FT                   /db_xref="GOA:C6B1F4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F4"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54673.1"
FT                   /translation="MTSILTNVAAMAALQTLRGINDSLEDTQNRVSSGYRVEKAADNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVISEIKAKIVAATEKGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFSGENWVAGADGTKSVVSSFVRDGNGNVSVKTTDYI
FT                   LDTSSTGNVLFGMDSTGAIETSSGLIGTSSGTIGSIYSMDITNFDSPEISMALTSIEAG
FT                   LEAMTKAASQLGSISTRIELQEGFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQ
FT                   LAIQSLSIANSSAQNILTLFRS"
     atgaccagca ttttgacgaa cgttgcggca atggccgctc ttcaaacact tcgcggaatc        60
     aacgacagcc tcgaggatac gcagaaccgc gtatcatcgg gttaccgcgt cgagaaggcg       120
     gccgacaacg ccgcctactg gtcgatcgca acgaccatgc gttccgacaa caaggctctc       180
     tcggctgtct ccgacgctct cggcctcggc gctgccaagg tcgacaccgc ttactccgcc       240
     atggacagtg ccatcgatgt catcagcgag atcaaggcga agatcgtcgc tgcaaccgaa       300
     aagggtgtcg acaaggctaa agtgcaggaa gaaatcggcc agctgcagca gcagctcctg       360
     agcatcgcgc aatcggcttc cttctccggt gaaaactggg tcgcgggcgc tgacggcacc       420
     aagagcgtcg tttcctcgtt cgtccgcgat ggcaacggca atgtctcggt caagacgacg       480
     gactacattc tggacacgag ctccacgggc aacgttctct tcggcatgga ctcgaccggc       540
     gcgatcgaga ccagctccgg ccttatcggc acatcatccg gtacgatcgg ctcgatctac       600
     tcgatggaca tcaccaactt cgattcgcct gagatctcca tggccctgac gtcaatcgag       660
     gcaggccttg aggcgatgac caaggctgca tcgcagctcg gctctatttc cactcgcatt       720
     gagctgcaag aaggcttcgt cagcgcgctc agcgattcga ttgactccgg tgtcggccgc       780
     ctcgtcgacg ccaatatgga agaagaatcc tccaagctca gcgctctgca gacccagcaa       840
     cagctggcca tccagtcgct gtcgatcgcc aactccagcg ctcagaacat cctcacgctg       900
     ttccgtagct aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page