(data stored in ACNUC7421 zone)

EMBL: CP001622.PE362

CP001622.PE362       Location/Qualifiers
FT   CDS_pept        371478..372440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0363"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000750 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54674"
FT                   /db_xref="GOA:C6B1F5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F5"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ACS54674.1"
FT                   /translation="MTVKITSAAAVNALAVLRSINKEASQTQQQVSSGYRIETAADDAS
FT                   YWSVATVMRSDSTNLGTIGDALGLGAAKVDATYTAMDSAIDLIGEIRAKLVSAREPGAD
FT                   KDKINAEISEYKEQLQTVVESTSFAGENWLLNGDAAAPPTWQVISGFVRAPTGEYQAQT
FT                   IDFPSSQTILIDKNNASGGLLTKSVDANAINNSGATSRNYYLLNANSTTPATGTEIAIG
FT                   KNTTDAQLTDMLDVTDSLLSSLTTTAASIGVMKTRIDDQIDYTANLSDSIDKSVGALVD
FT                   TDMDEASIRQKAIETQKQMAVEAISILNTAASKILILLE"
     atgaccgtta agattaccag cgcggccgcg gtgaatgcgc ttgcggtgct gcgcagcata        60
     aacaaagaag ccagccagac ccaacagcaa gtatcctcgg gatatcgtat cgagacggcc       120
     gccgacgatg cgtcctactg gtcggtcgcg accgtcatgc gttcggacag caccaatctc       180
     ggaacgatcg gagatgcgct cggcctcggc gctgccaagg tggatgcgac ctacacggcg       240
     atggactccg cgatcgatct catcggtgag attcgcgcca agctggtttc ggcaagagaa       300
     ccaggcgccg acaaggacaa gatcaacgcc gagatcagtg aatacaagga gcagttgcag       360
     acggtcgtcg aatcgacgtc gtttgcgggt gaaaactggc tgttgaacgg cgatgccgcc       420
     gcgccgccga catggcaggt gatctctggt ttcgtgcgcg ctccaaccgg cgaatatcag       480
     gctcagacca tcgatttccc atcctcgcag accatcctca tcgacaagaa caatgcgagc       540
     ggcggcctgc tgaccaagtc ggtcgatgcc aacgcgatca acaacagcgg cgcgacgtcg       600
     cggaactatt atctgctgaa cgccaactcc accacgccgg cgacaggtac ggaaattgcg       660
     attggcaaga acacgaccga tgcacaactc accgacatgc ttgacgtgac cgactcgctg       720
     ctctcctcgc tgacgaccac ggccgcgtcc atcggcgtga tgaagacgcg catcgacgat       780
     cagatcgact ataccgccaa tctgtccgat tcgatcgaca aaagcgtcgg tgcgctcgtc       840
     gataccgaca tggacgaggc ttcgatccgg cagaaggcga tcgaaaccca gaagcagatg       900
     gccgtcgaag cgatctcgat cctcaacacg gccgcaagca agatcctgat cctgctggaa       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page