(data stored in ACNUC7421 zone)

EMBL: CP001622.PE363

CP001622.PE363       Location/Qualifiers
FT   CDS_pept        372644..373273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54675"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000751"
FT                   /protein_id="ACS54675.1"
FT                   /translation="MSIALSRYLKDFGEPESSAPILDMDDFGSDAFPEMASEPAIDVEA
FT                   ERREAYAEGHAAATVELTEKYEREVRMLAEVHARELEELKLRYEVEAAAVIASRIRDIA
FT                   EEIAQLVSAGAAVAIAPVMTEALAAKAAESLASLLRDAILEGAAGAVVVRGPTRLFDIL
FT                   KAELGEHAEAVRHIETDDIDLAVEIGDAVIVTRMSAWAASLKKVLE"
     atgagcattg cgctttcccg gtatttgaag gatttcggtg aaccggaatc gtcagcgccg        60
     atcctcgaca tggacgattt cggcagcgac gctttccccg aaatggcgag cgaaccggcg       120
     atcgacgtcg aggcggagcg ccgcgaagcc tatgcggaag gtcatgccgc agcgaccgtg       180
     gaattgactg agaaatacga acgcgaggtg cggatgctgg cggaggtcca tgcgcgtgaa       240
     ctcgaagagc tgaagctgcg ttacgaagtc gaggcggcgg cggtcattgc atcccgcatc       300
     cgcgatatcg ccgaagagat cgctcaactg gtcagcgccg gcgccgccgt tgccatcgcg       360
     cctgtgatga ccgaagcgct tgccgccaag gctgccgaaa gcctcgcctc tctgctgcgt       420
     gacgcgatcc tcgaaggcgc ggccggagcg gtcgtcgtca gggggccgac ccggcttttc       480
     gacatattga aggccgagct cggcgaacat gccgaggcgg ttcgccacat tgagaccgac       540
     gatatcgatc ttgccgtcga aatcggtgat gccgtcatcg tcacccgtat gtccgcctgg       600
     gcggcaagct tgaagaaagt tctcgaatga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page