(data stored in ACNUC7421 zone)

EMBL: CP001622.PE364

CP001622.PE364       Location/Qualifiers
FT   CDS_pept        373270..374601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0365"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000752 chemotaxis motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54676"
FT                   /db_xref="GOA:C6B1F7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F7"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACS54676.1"
FT                   /translation="MSEGENHHHGKNEIIIVKRHGGGDHDGAHGGAWKIAYADFMTAMM
FT                   AFFLVMWLVNAANEETKASVATYFNPIKLSDEKPTEKGLKKPVDNAEGEEKQEKSKQKE
FT                   EDPNDGKAAADGDDQTSTSGDQTNYSEADFFENPYSVLAEIAQEVGQQANVSAKGDGGA
FT                   ADSGPATGADGGEAYRDPFDPDFWTKQVEVTTAGKPLPPGKSDDQAVESETTEIAKLED
FT                   AKPIPLTTDQKAAQETKETKETKGAVEAKDGKTPGGKSPEDKKAEAQKDADHQKDADKS
FT                   AAETEQQQQKEAEQLQAQIAQQIGGVAGKLAEGLTVTASEGGLLVSISDQTDDSMFNIG
FT                   SAVPRQEMVLAMEKIGAILKERGGAVAVRGHTDGRQYKGTQNENWRLSMDRAQSAYYML
FT                   VRGGLDEKRISQVSGFADRRLKLPSDPFNATNRRIEILVQADQG"
     atgagcgaag gcgaaaacca ccaccacggc aagaacgaga tcatcatcgt caagagacat        60
     ggcggcggtg atcacgatgg cgcccatggc ggtgcgtgga aaattgccta tgccgacttc       120
     atgacggcga tgatggcgtt cttcctggtc atgtggctgg tcaatgccgc caacgaggag       180
     accaaggcct cggtcgcgac ctatttcaat ccgatcaaac tctccgacga aaagccgacc       240
     gagaagggcc tgaagaagcc cgtcgacaac gccgagggcg aagagaagca ggagaagtcg       300
     aaacagaagg aagaagatcc gaacgacggc aaggccgcgg cggatggtga cgaccagaca       360
     tcgacctcag gcgaccaaac caattattcc gaggccgatt tcttcgaaaa tccttattcg       420
     gttctggccg agatcgccca ggaagtcggc cagcaggcca atgtcagcgc caagggcgac       480
     ggcggtgccg ccgattccgg cccggccacc ggcgccgatg gcggcgaggc ctatcgtgat       540
     cccttcgatc cggatttctg gacgaagcag gtcgaggtca cgacggccgg caagccgttg       600
     ccgcccggca agagcgacga ccaggcggtc gagagcgaga cgaccgagat cgccaagctt       660
     gaggacgcca agccgatacc gctgactacc gatcagaagg ccgcccagga aaccaaagaa       720
     acgaaggaaa ccaagggcgc ggtcgaggcc aaggacggca agacgccggg tggcaagtcg       780
     cccgaagaca agaaggccga agctcagaag gacgccgatc atcagaagga tgcggacaag       840
     agtgccgccg agaccgagca gcagcagcag aaggaagcag agcagctgca ggcgcagatc       900
     gcccagcaga tcggcggcgt tgccggcaag ctcgctgaag gtctgaccgt gacggcgtcc       960
     gaaggcggtt tgctggtcag catctccgat cagaccgacg attcgatgtt caatatcggt      1020
     tctgcggttc cgcgccagga gatggtgctg gccatggaaa agatcggcgc gatcctgaag      1080
     gagaggggtg gtgcggttgc cgtccgcggc cacacggatg gtcgccagta taagggcacg      1140
     cagaatgaga actggcggct ttcgatggat cgcgcccaaa gcgcctacta catgctcgta      1200
     cgcggcgggc tcgacgagaa acgcatctcc caggtctccg gctttgccga tcgtcggctg      1260
     aagctgccgt ctgacccgtt caacgcgacc aatcgccgga tcgagatcct ggtgcaggcg      1320
     gatcaaggat ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page