(data stored in ACNUC7421 zone)

EMBL: CP001622.PE365

CP001622.PE365       Location/Qualifiers
FT   CDS_pept        374606..375901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0366"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000753 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54677"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000753"
FT                   /protein_id="ACS54677.1"
FT                   /translation="MARRQHRYVGFVALGLAMLSPAGGNAQDPDDLAPYKMLRSLQFVQ
FT                   DSVVSGDHSAGEMQRFMLGTIDERLRTVDPSTFDDDRNVDAALIYAMSGGNPQTLEYLI
FT                   AHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATK
FT                   PTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGMLDRGMAYSQRYVRRFLHSPYAS
FT                   QFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYLRIARAAAISGKPELARMAVG
FT                   RVQSLGAGTDNPFGSLADFYGGMAGLPTEDIDQAAKNVSGIDGNALSPRDQALQEAARS
FT                   VADQILRAPDPASLTQASDPNTDHQEITSEKAAAIATQPGAPGALPEPVPGGVASTGQS
FT                   QDTDPSFNAFVTTNRSKLDEIDGLLAQEGNEQ"
     atggcgcgtc ggcagcaccg ttacgtcgga tttgtggccc tcggcctggc gatgctttcg        60
     ccggccggag gcaacgcgca ggatccggac gatctcgcgc cctacaagat gctgcgatcg       120
     ttgcaattcg tgcaggattc cgtcgtcagc ggcgatcatt cggccggcga gatgcaacgc       180
     ttcatgctgg gcacgatcga cgagcggctg cgcactgtcg atccttcgac attcgacgac       240
     gaccgcaacg tcgacgcagc gctgatctac gcgatgagcg gcggcaatcc ccagacactc       300
     gaatatctga tcgcccatga cgtcaacggc tatttcgaca accgcgtcac cgatgtgctg       360
     cgcaaatatc tgagcggcaa ggggctgctc gtcgccaaga cactggagga gacggccaga       420
     gaatatcgcg acaagaagat cggcccctac cttgccctga tcggcggcaa cgtattgatc       480
     gcgacgaaac cgacagacgc gctggatctc tacgaccagg cgcgtcttgc cgctccgggt       540
     acgatcgtcg aggaggcggc gttgcgccgc tccgtcgcca tctgcgtcga caagggaatg       600
     ctcgacaggg gaatggccta ttcgcagcgc tatgtcagac gcttcctgca ttcgccctat       660
     gccagccagt tcgccgatct tttcgtcacg ctcgtcgtcg gccacgatca cgacgtgaaa       720
     ccgcaggatg tcatcgacat cctgtccttc atggacgccc cgcgccaacg cgaggtctat       780
     ctgcgcatcg cccgcgctgc cgcgatatca ggcaagccgg agctggcgcg catggcggtc       840
     ggtcgcgtgc agtcgcttgg cgccggcacc gacaatccct tcggttcgct tgcagatttc       900
     tatggcggca tggccggcct tcccacagag gatatcgatc aggcggcgaa gaatgtcagc       960
     ggcatcgacg gcaacgcgct gtcgccgcgg gatcaggcgc tgcaggaggc cgcgcggtcc      1020
     gtcgccgacc agatcctgcg cgctcccgac ccggcaagcc tgacgcaagc ctcggatcct      1080
     aacactgacc atcaagaaat cacttctgaa aaggctgcgg ctatagccac gcaaccggga      1140
     gcgccaggcg cgcttcccga gcctgttccg ggaggtgtgg catcgactgg ccaaagccag      1200
     gataccgacc cctcattcaa cgcatttgtg acgaccaatc gatccaagct cgacgagatc      1260
     gacggtcttc tggcgcagga aggcaacgaa caatga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page