(data stored in ACNUC7421 zone)

EMBL: CP001622.PE366

CP001622.PE366       Location/Qualifiers
FT   CDS_pept        375898..377331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0367"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000754 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54678"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000754"
FT                   /protein_id="ACS54678.1"
FT                   /translation="MMDMSVSGGAPGAESAATAKSARPAGKDDAAGQKNGFSDALAKAS
FT                   GSAANDDADDAQPNQGVAADGSAEKAAQSIRGRNGAKPLIDLSDAALKAQAEAQPETIV
FT                   SADKAAAKPVKAEIKMPTDLGLGKLDPKDSSANGVAPAAKGGKHTKADALETDTDKASD
FT                   DDDGGISDVLGLLKQEPADGTVTLPAATAHHVSANVDEAGAADKKIDGIEAKAGGHASD
FT                   ALAAVSGNVESGKADNIKVPGSQAAEAADGKTFRISRADGRGVSMDVHIGTDQVGPKDG
FT                   SKKADVENVSVLESRRYIGLMQNSNSAAVTAALSGDSEWARAMEPSSALSNAAEWTSTG
FT                   RVVNTLKIQMNPLDLGLVTATMRLSGDALNVDLKVETGAAYRQMKEDHGKILEALRSQG
FT                   YAVENVTISMAPVERSDAGNQGQASQQQSPPQQGQGGEARERHNQTAQRTDGGFNGAGE
FT                   TGIEDARAGGSSGTGGVYL"
     atgatggata tgagcgtctc gggcggagcc cccggtgcgg agtccgccgc gactgcgaaa        60
     tctgcgcgac cggccggaaa agacgatgcc gccggccaaa agaacggctt ctccgacgcg       120
     ctggccaagg caagcggcag tgctgccaat gacgatgccg acgatgcgca gccgaatcag       180
     ggcgtggcag ccgatggcag cgccgagaaa gcggcgcagt cgatccgcgg ccgcaacggc       240
     gcaaagccgt tgatcgatct tagcgacgcc gcgctgaagg cacaggcgga ggcgcagccg       300
     gaaacgatcg tcagtgctga caaggccgcg gcaaagccgg taaaggccga gatcaaaatg       360
     ccgaccgatc tcggcctcgg caagctcgat ccgaaggaca gttccgcaaa cggggtcgct       420
     ccggcagcca agggcggcaa acacaccaag gccgacgcgc tggaaaccga tacggataag       480
     gccagcgacg atgatgacgg cggcatttcc gatgttctgg gtctgctgaa gcaggagcct       540
     gccgacggga ccgtgacttt gccggcggcc accgcgcatc acgtctctgc aaacgtcgac       600
     gaggctggag ctgccgacaa aaaaatcgat ggtatcgaag ccaaggcggg cggccatgcg       660
     tccgacgctc ttgccgccgt cagcggcaac gtcgagagcg gcaaggcgga taatatcaag       720
     gttcccggat cgcaggctgc cgaagccgcc gatggaaaga cattcaggat cagccgcgcc       780
     gatggccgcg gcgtctcgat ggatgtccac atcggcaccg atcaggtcgg tccgaaagat       840
     ggctcgaaga aggccgatgt cgaaaacgtt tcggtgctcg aatcgcgccg ctatatcggc       900
     ctgatgcaga attcgaattc cgctgccgtt accgccgctc tctccggcga ttccgaatgg       960
     gcgcgcgcca tggagccgag ctcggcgctc tccaacgcgg cggaatggac gagcaccggc      1020
     agggtggtca atacgttgaa gatccagatg aacccgctcg atctcggtct ggtgacggcg      1080
     accatgcgcc tgtccggcga cgccctgaac gtcgacctca aggtcgaaac cggggccgcc      1140
     tatcgtcaga tgaaggaaga tcacggcaag attctcgaag ctctgcgcag ccagggttac      1200
     gcggtcgaaa acgtcaccat cagcatggcg ccggtcgagc gttccgacgc cggcaaccag      1260
     ggccaggcct cccagcagca gtcgcccccc cagcaggggc agggcggcga ggcgcgcgag      1320
     cgccacaatc agacggcaca gcggacggac ggaggcttca atggcgcagg cgagactggt      1380
     attgaagacg ctcgtgctgg cggcagcagc ggtactggcg gcgtttacct ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page