(data stored in ACNUC7421 zone)

EMBL: CP001622.PE367

CP001622.PE367       Location/Qualifiers
FT   CDS_pept        377279..377836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0368"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ret:RHE_CH00677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54679"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G0"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACS54679.1"
FT                   /translation="MKTLVLAAAAVLAAFTSEATASTGACEREIQSAAAKYGIPEGILY
FT                   SVGLTETGRKGSLYPYAMNVEGKAIFPPSEQDAMRQFDVARNSGAKLIDIGCMQINHYF
FT                   HGENFRSAEEMFDPHRNVEYAAKFLRNLHDRHETWTMAVARYHAGPNNNPAQKQYVCRV
FT                   ISNLVATGYGKWTLNASNFCRN"
     ttgaagacgc tcgtgctggc ggcagcagcg gtactggcgg cgtttacctc tgaggcgacc        60
     gcctccaccg gcgcctgcga acgcgagatc cagtcggcag cggccaaata cggcatcccg       120
     gaagggatcc tctattcggt cggtctgacg gaaaccggcc gcaagggctc gctctatccc       180
     tatgccatga acgtcgaagg caaggcgatc tttccgccct cggagcagga cgcgatgcga       240
     cagttcgatg tcgcccgcaa cagcggcgcc aagctcatcg acatcggctg catgcagatc       300
     aaccattact ttcacggcga gaatttccgg tccgccgagg agatgttcga cccgcatcgc       360
     aacgtcgagt atgcggcaaa attcctccgc aatctgcatg accgtcacga gacatggacg       420
     atggcggtgg ccagatacca tgccggaccg aacaataatc cggcacagaa gcaatatgtc       480
     tgccgcgtca tctccaatct cgtcgccacg ggttacggca aatggactct caatgcgagt       540
     aacttttgcc gaaattga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page