(data stored in ACNUC7421 zone)

EMBL: CP001622.PE368

CP001622.PE368       Location/Qualifiers
FT   CDS_pept        378117..378788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0369"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: ret:RHE_CH00678 two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54680"
FT                   /db_xref="GOA:C6B1G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G1"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACS54680.1"
FT                   /translation="MIVVVDERELVKDGYTSLFGREGIPSTGFDPAEFGEWVQTAADSD
FT                   IAAVEAFLIGQGQRNFELPRAIRDRSMAPVIAVSDQHSLENTLALFDCGVDDVVRKPVH
FT                   PREILARAAAIRRRLKAITNYTEIGGIRVFSDGRDPEINGEVFALPRRERRILEYLIAN
FT                   RGRRVTKTQIFNAIYGIFDEEVEENVVESHISKLRKKLRKKLGVDPVDSKRFLGYCIDW
FT                   A"
     atgatcgtag tggttgatga gcgtgagctc gtgaaagatg gatacacatc tctgttcggt        60
     cgtgagggca ttccctccac cggctttgat ccagcggaat tcggcgagtg ggtacaaacc       120
     gccgccgatt ccgatatagc tgcagtcgag gccttcttga tcggtcaagg ccagcgcaac       180
     ttcgaactgc cccgggcgat ccgggatcgg tcgatggcgc cggtgattgc ggtcagcgat       240
     cagcactcgc tcgaaaacac ccttgcgctg ttcgattgcg gcgtcgacga cgtggtgcgc       300
     aaaccggtgc atccccgcga aatcctcgca agggcggctg cgatccggcg ccggctgaag       360
     gcgatcacca actataccga gatcggcggg attcgcgtct tctcggatgg ccgtgacccc       420
     gagatcaacg gcgaagtctt cgcacttccc cggcgcgagc gccgcatcct cgaatatttg       480
     atcgccaatc gcggtcgccg cgtcaccaag acccagatct tcaacgccat ctacggcatc       540
     ttcgatgaag aggtcgagga gaacgtcgtc gaaagccaca tctcgaagct gcgcaagaag       600
     ctgcgcaaaa agctcggcgt cgatccggtc gattccaagc gcttccttgg ttactgcatc       660
     gattgggcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page