(data stored in ACNUC7421 zone)

EMBL: CP001622.PE369

CP001622.PE369       Location/Qualifiers
FT   CDS_pept        378912..380210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0370"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body FlaE domain protein;
FT                   flagellar basal body rod protein; KEGG:
FT                   rec:RHECIAT_CH0000757 flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54681"
FT                   /db_xref="GOA:C6B1G2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G2"
FT                   /inference="protein motif:PFAM:PF06429"
FT                   /protein_id="ACS54681.1"
FT                   /translation="MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSS
FT                   LVLPSSGGNYNSGGVQTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGPDGTPVLTR
FT                   AGDFTKDDEGNLVNAAGFMLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGI
FT                   FKGNLDSNAKIAPVAPATLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKKTVVT
FT                   PPPATPATAATWEVSMFRNADAAVGGTTSFPYSTASVGTGTLSFDANGKLTAGGAVNIV
FT                   DPVTGQTIAMDFSAFTQLGADFSGTGTPNGQAATPVKDVTVDGDGIVYAKYEDGSTKPL
FT                   YRIPLANVASPDKLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGE
FT                   LTEMIESQRSYTANSKVFQTGSDIMDVLVNLKR"
     atgagcattt tcggcagcat gaagacggca gtatcgggga tgaacgcgca ggccaaccgc        60
     ctcagcaccg tcgccgacaa catcgccaac gttaacacga ccggttacaa ggccgtgtcg       120
     acgagcttct cgtcgctggt tctgccctcc tcgggcggca actacaattc cggcggcgtt       180
     cagacctccg tccgccaagc cgtctccgac cagggcgata tttcctacac cacgtcgagc       240
     accgaccttg caatctcagg cgacggcttc ttcatcgtcc agggtcctga cggcaccccg       300
     gttctgaccc gcgccggcga cttcaccaag gacgacgaag gcaatctcgt caacgccgcc       360
     ggcttcatgc tgatgggtta ttcctacgac tccggctctc ctgctgtcgt cgtcaacggc       420
     ttcgatggcc tcgttcccgt caacgtcaac caggatgggt tgaccgccat cgcctcgacc       480
     tcaggtatct tcaagggcaa cctcgactcc aatgccaaga tcgctccggt cgctcctgcg       540
     acgctgccga gcgccaacct cgccacgacg acgaccgaca ccaagaaggt ctcgatggtc       600
     gcctatgacc gtctcggcaa caaggtgatg tacgacttct acttcacgaa aaaaacagtt       660
     gttacgccgc cgccggcaac gcccgctacg gctgccacct gggaagtgtc gatgttccgc       720
     aacgccgatg ctgcggtggg cggcacgacc tccttcccct acagcaccgc ctctgtcggc       780
     accggaacgc tcagcttcga cgccaacggc aagttgaccg cgggcggcgc cgttaacatc       840
     gtcgacccag tgactggtca gacgattgcc atggacttct ccgccttcac acagctcggt       900
     gccgacttct ccggcaccgg cacgccgaac ggtcaggcag cgaccccggt caaggacgtc       960
     acggttgatg gcgacggcat cgtctacgcg aaatacgaag acggcagcac caagccgctc      1020
     tatcgcattc cgctggccaa tgtcgctagc ccggacaagc tgacgctgat gagcggcaac      1080
     gtctacagcg ccaacggcca gtcgggcgtc accgtcaccg gcttcccgca gaccaacggt      1140
     ctcggcacga tcaaatcagg cgctctcgaa ggttcgaacg tcgacctcgc cggcgagctg      1200
     accgagatga tcgaatcgca gcgcagctat accgccaatt ccaaggtgtt ccagacggga      1260
     tccgacatta tggacgttct cgtcaacctc aagagataa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page