(data stored in ACNUC7421 zone)

EMBL: CP001622.PE37

CP001622.PE37        Location/Qualifiers
FT   CDS_pept        complement(34214..35278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0038"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rec:RHECIAT_CH0000423 tryptophanyl-tRNA
FT                   synthetase protein; TIGRFAM: tryptophanyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54349"
FT                   /db_xref="GOA:C6AYC5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC5"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACS54349.1"
FT                   /translation="MSEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAEHISRTGYGVDITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKA
FT                   DVLAEFGGQQFSVFKPALVDLAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMRQVRDVIGFLY"
     atgagcgaat tcaagaaact cgtattctcc ggcgtgcagc cgaccggcaa tctgcatctc        60
     ggcaattatc tcggcgcgat ccgccggttc gtggcgctgc aggaaggcaa tgactgcatc       120
     tactgcgtcg tcgacatgca tgcgctcacc gcccagctcg tgcatgagga catgccgagc       180
     cagacgcgct cgatcgccgc cgccttcatc gctgccggca tcgatccgga aaagcatatc       240
     gtcttcaatc agtcggccgt gccgcagcat gccgaactcg cctggatctt caactgcgtc       300
     gcccgcatcg gctggatgaa ccggatgacg cagttcaagg acaaggccgg caaggaccgc       360
     gagcaggcct cgctcgggct ctacgcctat ccgagcctga tggccgccga cattctcgtc       420
     tatcgcgcca cccatgtgcc tgttggtgag gaccagaagc agcatctgga gcttgcccgc       480
     gacatcgcga tgaagttcaa cctcgactat gccgagcata tcagcaggac cggttacggc       540
     gtcgacatca ccgtcggcaa cgagccggtg catgcctatt tcccgatggt cgagccgttg       600
     atcggcgggc cggcgccgcg cgtcatgtcg ctgcgcgacg gcaccaagaa aatgtcgaag       660
     tcggaccctt ccgatctctc gcgcatcaac ctgatggacg acgaggacgc tatctcgaag       720
     aagatccgca aggccaagac cgatcctgac ggcttgccga gcgagatcga cgggctgcag       780
     ggccgtccgg aagccgacaa tctggtggcg atctatgccg cactcgccga caagtcgaag       840
     gcggacgtgc ttgccgaatt cggcggccag caattctccg tcttcaagcc ggcgctggtc       900
     gacctggcga tcaacgtgct cgcaccgatc accggcgaaa tgcgccggct gatggatgat       960
     accagccata tcgacgcgat cctgcgcaag ggcggcgagc gcgcaagggc gcgcgcagag      1020
     gtgacgatgc gccaagtgcg cgacgtcatc ggcttcctgt attga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page