(data stored in ACNUC7421 zone)

EMBL: CP001622.PE370

CP001622.PE370       Location/Qualifiers
FT   CDS_pept        380230..381717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0371"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: ret:RHE_CH00680 flagellar hook-associated protein
FT                   FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54682"
FT                   /db_xref="GOA:C6B1G3"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G3"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ACS54682.1"
FT                   /translation="MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTT
FT                   SLNGAQVVKIDRAQEEALLRQYLKTSSQDSAQQALLGGLEDLKSIVGGNDYETSPSTYL
FT                   GVFQQKLQAFRTTPGSTVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKL
FT                   NTLLNDFEKANNAVKTATASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTS
FT                   DGTILFETIPRKVTFKSQDVYTATITGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRD
FT                   EIAPNFQKQLDEVARGLVSLFKEQNTAAGPAYVPGLFTWSGGTVDTGATAVAGMAATIT
FT                   VSSRVITSQGGDPMRLRDGGVNATGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGT
FT                   PVGFDATTGIDSNVSIMEFATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVN
FT                   LDEELTLLLDIEQSYKAATKILNAVDEMLKSLLDIAS"
     atgtcgctca catccgcact taataccgcg cagaacatat tcaacaatac gggtactcag        60
     agcagtgtcg tatcgaacaa tatctcgaat gcgggcaaca aagattacgt gcgccggcag       120
     gcgatgctca ccacgtcctt gaatggcgca caggtcgtca agatcgatcg ggcgcaggaa       180
     gaggcgctgc tgcgccaata cctgaagaca tcctctcagg acagtgccca gcaggcattg       240
     ctcggcggtc tcgaggacct caagtcgatc gtgggtggca acgactacga aacgtcgcca       300
     tccacctatc tcggtgtttt ccagcagaag cttcaggcct tccgcacgac gccgggcagc       360
     accgtcgctg ctcagggcgc catcaccgcc gcgcaggacg tcgccaactc gctgaacaat       420
     gcctcgcaat ccgttcagaa cgtccgcgcc accgccgaca agcagatcgc caccgacgtc       480
     gataaactga atacgcttct caacgacttc gagaaggcca acaacgcggt gaagaccgcc       540
     acggcctcgg gtgcggatgc atccggcgcg ctcgacgagc gtgagaaggc tctcaagcag       600
     atttcgcaga tcgtcggcgt caacacgacg acgcgcgaca ataacgacat ggtgctgagc       660
     acctctgacg ggacgatcct cttcgagacg atcccgcgca aggtgacgtt caagtctcag       720
     gatgtctata ccgcgaccat caccggcaat tcggtctatg ttgacggtgt ggcacttcca       780
     cgcggcagcg gatcgacgac gacggggcag ggaagccttc agtctctcct ccaggtccgc       840
     gacgagatcg ccccgaattt ccagaagcag ctcgacgaag tcgcccgcgg cctggtctcg       900
     ctcttcaagg agcagaacac ggcagccggc ccggcctatg tgcccggcct cttcacctgg       960
     agcggcggca cggtcgatac cggcgccacc gcggttgccg gcatggcggc gaccatcaca      1020
     gtcagcagcc gcgtcatcac ctcgcaaggc ggcgatccga tgcgcttgcg cgatggcggc      1080
     gtcaacgcca ccggcctcgt cctgaacacg tcaggcgcca gcggttatac gacggaactc      1140
     gatcgtctct ataccgcatt gggctccgac atcgatttcg atccagcggc ggggacgcct      1200
     gtcgggttcg acgccacgac aggcatcgat tcaaacgtca gcatcatgga attcgccaca      1260
     aattccctcg gctggctcga acagtaccgt agcaatgcca cgacggcagc ggaaaacacc      1320
     tcggcggcgc tgtcacgctc tgacgaagcc tattccaacg agacgggcgt caacctcgac      1380
     gaggagctga cgctgctcct cgacatagag cagtcctaca aggcggcgac caagatcttg      1440
     aacgccgttg acgaaatgtt gaagtcattg ctggatattg cgagttaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page