(data stored in ACNUC7421 zone)

EMBL: CP001622.PE371

CP001622.PE371       Location/Qualifiers
FT   CDS_pept        381721..382773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0372"
FT                   /product="flagellar hook-associated 3 family protein"
FT                   /note="PFAM: flagellar hook-associated 3 family protein;
FT                   KEGG: ret:RHE_CH00681 flagellar hook-associated protein
FT                   FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54683"
FT                   /db_xref="GOA:C6B1G4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G4"
FT                   /inference="protein motif:PFAM:PF07164"
FT                   /protein_id="ACS54683.1"
FT                   /translation="MKSSFISSSAIQNAMRLTIRQAQNQMTKATMEATTGVYADIGVSL
FT                   GGNAARSVDFSREVDRIDSIKSSNSLVTARMESSQLGLSKMKDVGDGLVSKLTALQGSH
FT                   DPGSITVAIQSATSALSTMMDTANTMVNGEYLFSGINTDVQPLTDKTTATSAAIVTELN
FT                   TYAAALVPPKAVSALTGAEMSTFITTKVEPMFSQAAWTDPTTGWSQASSQNMTSRISNS
FT                   EVIESSTNANSEGMRYFALASVMTSALLGQGLSSDAMSTVSKQAISYTTKATSGLVTQA
FT                   SQLGLSQERVKKSNDALDAQSNIIKNKLVDLQGVDPYEASTLVKTLETQLETAYTIVSK
FT                   IQQLSLVNYL"
     atgaagagct catttatttc aagttcggcc attcagaatg cgatgcggtt gacgatccgt        60
     caggcgcaga accagatgac gaaggcgacg atggaagcga cgacgggagt ctatgcggat       120
     atcggtgtct cgctcggcgg caacgccgcc aggagcgtgg acttcagccg cgaggtcgac       180
     aggatagact cgatcaaatc aagcaattcg cttgtcaccg cgcgcatgga atcctcgcag       240
     ctcggccttt ccaagatgaa ggatgtcggc gacggcctcg tttcgaagct gacggcgctc       300
     cagggcagcc atgatcccgg tagcatcacc gtcgccatcc agtcggcgac cagcgccctg       360
     tccacaatga tggacacggc caataccatg gtaaacggcg aatatctgtt ctcgggcatc       420
     aacaccgatg tgcagccgct gaccgacaag acgaccgcga ccagtgccgc catcgtcacg       480
     gagttgaata cttacgccgc cgctctcgtc ccgccgaagg cggtcagtgc tctcaccggc       540
     gccgaaatga gcaccttcat caccacgaag gtagagccga tgttcagcca ggccgcctgg       600
     accgacccga cgaccggctg gtcgcaggca tcgagccaga acatgacgag ccgcatcagc       660
     aactccgagg tgatcgaatc ctcgaccaat gccaattccg agggcatgcg ttacttcgcg       720
     ctcgcctcgg tgatgacctc ggcgctgttg ggccagggcc tcagcagcga tgcgatgagc       780
     acggtgtcca aacaggcgat cagctatacg accaaggcga ccagcggcct cgtgacccag       840
     gcaagccagc tcggcctttc ccaggagcgc gtcaagaagt ccaacgacgc cctcgacgcc       900
     cagtccaaca tcatcaagaa caagctcgtc gacctccagg gcgtcgatcc ctatgaagcc       960
     tcgaccctcg tcaagacttt ggaaacgcag cttgaaaccg cttacacgat cgtctcgaag      1020
     atccagcagt tgagtcttgt aaactacctt tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page