(data stored in ACNUC7421 zone)

EMBL: CP001622.PE372

CP001622.PE372       Location/Qualifiers
FT   CDS_pept        382808..383155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0373"
FT                   /product="flagellar FlaF family protein"
FT                   /note="PFAM: flagellar FlaF family protein; KEGG:
FT                   rec:RHECIAT_CH0000760 flagellin synthesis regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54684"
FT                   /db_xref="GOA:C6B1G5"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G5"
FT                   /inference="protein motif:PFAM:PF07309"
FT                   /protein_id="ACS54684.1"
FT                   /translation="MYQFSYAEVMQDSVADAKEREWQVLDRSIDLLAAAREKEKYGREA
FT                   IEALFYTRRVWISFIEDLKHPDNQLEIGLRANLISIAIWILKECDRIRKRQSNNYQGII
FT                   DVTTIIRDGLK"
     atgtatcagt tctcatatgc cgaagtcatg caggactcgg tagccgacgc gaaagagcgg        60
     gaatggcagg ttcttgaccg gtccatagac ttgctggcgg cggcgcgcga aaaggaaaaa       120
     tacggccggg aagccattga agccctgttt tatacacgcc gggtctggat cagcttcatc       180
     gaggatctca aacatcccga caaccagctg gagatcgggc tcagggccaa cctcatctcg       240
     atcgcgatct ggatattgaa ggaatgcgac aggatcagaa aacgtcagtc taataactac       300
     cagggcatca tcgacgttac caccatcatc agggatggac ttaaatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page