(data stored in ACNUC7421 zone)

EMBL: CP001622.PE373

CP001622.PE373       Location/Qualifiers
FT   CDS_pept        383152..383601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0374"
FT                   /product="flagellar FlbT family protein"
FT                   /note="PFAM: flagellar FlbT family protein; KEGG:
FT                   rec:RHECIAT_CH0000761 flagellin synthesis regulator
FT                   (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54685"
FT                   /db_xref="GOA:C6B1G6"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G6"
FT                   /inference="protein motif:PFAM:PF07378"
FT                   /protein_id="ACS54685.1"
FT                   /translation="MKSTLRISLKAGERIFINGAVLRVDRKVALEFLNDVTFLLENHVL
FT                   QPEGATTPLRQLYFIAQMILINPEGKDHSTALFRKSITMLLTCFKNEEILAELKRIDAL
FT                   VSTGRAFDALKAIRGLYAIEDNILNNHEMPPTMVEQIRREIAPWR"
     atgaaaagta cacttcgcat ttctctgaaa gccggagaaa gaatcttcat caacggcgcc        60
     gtcctgcgcg tcgaccgcaa ggtcgcgctg gaattcctga atgatgtgac gttccttctc       120
     gaaaaccacg tcctccagcc ggagggcgcc acgacgccgc tgcgtcagct ctatttcatc       180
     gcgcagatga tcctcatcaa tccagagggc aaggaccact cgacggcgtt gttccgcaag       240
     tcgatcacca tgctgctcac ctgcttcaag aacgaagaga tcctcgccga actgaagcgc       300
     atcgatgcgc tcgtctcgac tggtcgcgcc ttcgatgcac tcaaggcgat ccgcggcctc       360
     tacgcgatcg aagacaatat cctcaacaac cacgaaatgc cgccgacgat ggtcgagcag       420
     attcgcaggg agattgcacc atggcggtag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page