(data stored in ACNUC7421 zone)

EMBL: CP001622.PE374

CP001622.PE374       Location/Qualifiers
FT   CDS_pept        383592..384026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0375"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ret:RHE_CH00684 flagellar basal body rod modification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54686"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G7"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ACS54686.1"
FT                   /translation="MAVDATSSVANTSSTSTTNTAQQKATLNYDNFLQLLIAQMKNQDP
FT                   TDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLASSSLTQASSYVGKYMESADGTVKGT
FT                   IESVKVYSDGIIATTTDGGNILVQAGITVADKAPTTSTDT"
     atggcggtag atgcaacatc aagcgtggcc aacacgagtt cgacgagtac gacgaacacg        60
     gcccagcaga aggcgacgct gaactacgac aatttccttc aactgctcat cgcgcagatg       120
     aagaaccagg atccgaccga tccggtcgac gccagcgaac agatgtcgca gctggcgagc       180
     ttctcgcagg tcgagcagac gatccagacc aacaccaagc tggacacgct gctcgccagt       240
     tcgagcctca cccaggccag cagctacgtc ggcaaataca tggaaagcgc cgacggcacc       300
     gtcaaaggca ccatcgaatc cgtcaaggtt tattccgacg gaatcattgc gacgaccacg       360
     gatggcggta atatactcgt gcaggcggga atcaccgttg ccgacaaggc gccgacgacg       420
     tcgaccgata cctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page