(data stored in ACNUC7421 zone)

EMBL: CP001622.PE375

CP001622.PE375       Location/Qualifiers
FT   CDS_pept        384126..384392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0376"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: rec:RHECIAT_CH0000763
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54687"
FT                   /db_xref="GOA:C6B1G8"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G8"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ACS54687.1"
FT                   /translation="MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQ
FT                   EATLTFVPKIVAVLITVGVTAPFVGSQISIFTNLVFSRIQSGF"
     atgaatgaag ctgatgcatt ggatctgttc caggcggcga tctggaccgt gttgattgct        60
     gccggtcccg ccgtcatcgc cgcgatggtg gtaggtctcg tcattgcctt gatccaggcg       120
     ctgacccagg tgcaggaagc gacactgact ttcgtgccga agatcgtcgc ggtgctgatc       180
     acggtcggtg tcaccgcgcc gttcgtcggt tcgcagatct cgattttcac caatctggtc       240
     ttctcgcgca tccagtccgg cttctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page