(data stored in ACNUC7421 zone)

EMBL: CP001622.PE376

CP001622.PE376       Location/Qualifiers
FT   CDS_pept        384608..386695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0377"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: ret:RHE_CH00686
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54688"
FT                   /db_xref="GOA:C6B1G9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G9"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ACS54688.1"
FT                   /translation="MAQPPALPLPKVAPNLRDVGFALGIIVIICILFLPIPPFLIDMGL
FT                   AFSIALSVLILMVALWIQKPLDFSSFPTILLIATMTRLALNIATTRVILSHGHEGHDAA
FT                   GGVIAGFASLVMSGDFVIGLIVFLILITINFIVITKGATRIAEVGARFTLDAIPGKQMS
FT                   IDADLSAGIIDEREAQRRRKELEEESSFFGAMDGASKFVRGDAVAGLIITCINIFGGII
FT                   IGYFRHGMPIGEAADVFVKLSVGDGLVAQMPALIVSLAAGLLVSRGGTTGSTDQAVVNQ
FT                   LSGYPRALSVSAVLMFILALMPGLPFVPFVSLGGLLAFGAWFIPRQVEAENMLRREQEE
FT                   KKVVQSKELEKDSVKAVLRTSEIELALGKMVSTRLLGAHQELAFRVGKMRKKFATQYGF
FT                   VVPEIKVTDDIAIAEKSYQIRIHGTTVASNLLRVGEVLVVTGAGRRPSIPGDEIREPAF
FT                   GMPAVSILENFADDLKREGFQPIDNVSVVLTHMSEVIRNNLPQLLSYKDVKVLIDRLDP
FT                   EYKKLADEICSSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRIRMAQQLCGDLADNGVLRVLRLGSKWDLAFHQALKRDAKGEVIEFDIDPRSLEEFSE
FT                   QATKVIREFMDRGLPFALVTSPETRSYVRMIIERLFATLPVLSHVELAKGIEIKILGSI
FT                   S"
     atggcgcaac cacctgcact cccccttccg aaagtcgccc cgaacctgcg cgatgtcggt        60
     tttgccctcg gcatcatcgt tatcatctgc atcctcttcc tgccgatccc gccattcttg       120
     atcgacatgg gactggcctt ctcgatcgcc ctctcggtgc tgatcctgat ggtcgcgttg       180
     tggatccaga aaccgctcga tttctcgtct tttccgacca ttcttctgat cgcgacgatg       240
     acgcggctgg cgttgaacat cgcgacgacc cgcgtcattc tttcgcatgg tcatgagggc       300
     cacgatgcgg cgggcggtgt catcgcgggt ttcgcaagcc tggtgatgtc cggtgacttc       360
     gtcattggtc tgatcgtctt cctgatcctc atcaccatca acttcatcgt catcaccaag       420
     ggtgctacgc gtatcgccga agtcggcgcg cgtttcaccc tggatgccat ccccggcaag       480
     cagatgtcga tcgacgccga tctatcggcc ggcattatcg acgagaggga agcccagcgc       540
     cggcgcaagg agctcgagga ggaaagctcc ttcttcgggg cgatggacgg tgcgtcgaaa       600
     ttcgtgcgcg gcgatgccgt cgccggcctg atcatcacct gcatcaacat cttcggcggc       660
     atcatcatcg gctatttccg ccacggcatg ccgatcggcg aagcggccga cgttttcgtc       720
     aagctctccg tcggcgacgg cctcgtcgca cagatgccgg ctctcatcgt ctcgctcgcg       780
     gccggccttc tcgtctcgcg cggcggcacc accggctcca ccgaccaggc ggtcgtcaat       840
     cagctgagcg gttatccccg tgcgctttcc gtctcggcgg tgctgatgtt catcctggcc       900
     ctgatgccgg gcctgccgtt cgtccccttc gtatccctcg gcggtcttct ggccttcggt       960
     gcctggttca tcccacgtca ggtcgaggca gagaacatgc ttcgccgcga gcaggaagaa      1020
     aaaaaggtcg tccagagcaa ggaactggaa aaggattcgg tcaaggcagt gctgcgcacc      1080
     tccgaaatcg agctcgcact cggcaagatg gtctcgacgc gcctgctcgg cgcccaccag      1140
     gagctggcct tccgcgtcgg caagatgcgc aagaagttcg ccacgcaata cggcttcgtc      1200
     gtgcccgaga tcaaggtcac cgacgatatc gccatcgccg agaagtccta ccagatccgt      1260
     atccacggca cgacggtcgc ctccaaccta ctgcgcgtcg gcgaagtcct cgtcgtgacc      1320
     ggcgccggcc gccggccgag cattcccggc gacgaaatcc gcgaacccgc tttcggcatg      1380
     cctgccgtct cgatcctcga aaacttcgcc gacgatctga aacgcgaggg cttccagccg      1440
     atcgacaacg tctccgtcgt gctcacccat atgagcgagg tgatccgcaa caacctgccg      1500
     cagctgctgt cctacaagga cgtcaaggtg ctgatcgatc ggctcgatcc cgaatacaag      1560
     aagctcgccg acgagatctg ctcgtcgcac atgtcctatt ccggcctgca ggcggtgctc      1620
     aagctgctgc ttgccgaacg tgtctcgatc cgcaacctgc acctcatcct tgaagcggtg      1680
     gccgagctcg ccccgcatgt caggaagacc gagcagattg tcgagcatgt ccgcatccgc      1740
     atggcccagc agctttgcgg cgacttggcc gacaacggcg tgctgcgcgt gctgcggctg      1800
     ggcagcaaat gggatctcgc tttccaccag gcgctgaagc gcgacgccaa gggcgaggtg      1860
     atcgaattcg acatcgatcc gcgcagcctg gaggagttca gcgagcaggc caccaaagtt      1920
     atccgtgagt tcatggatcg cggcctgcca ttcgcacttg tcacgtcgcc ggaaacacgc      1980
     tcctatgtgc gcatgatcat cgagaggctg ttcgccacgc tcccggtcct gtcgcatgtc      2040
     gaactggcca agggcatcga gataaagatt ttgggctcta tttcatga                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page