(data stored in ACNUC7421 zone)

EMBL: CP001622.PE377

CP001622.PE377       Location/Qualifiers
FT   CDS_pept        386692..387444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0378"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /note="PFAM: type III secretion system inner membrane R
FT                   protein; KEGG: rec:RHECIAT_CH0000765 flagellar biosynthesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54689"
FT                   /db_xref="GOA:C6B1H0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H0"
FT                   /inference="protein motif:PFAM:PF01311"
FT                   /protein_id="ACS54689.1"
FT                   /translation="MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPDQLRVFIAGA
FT                   LSIAVMPLLWDTVYPAVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMM
FT                   VGYTQPGSADILEDTPETSLSGFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQ
FT                   MRATLISFTDTLEQTTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLM
FT                   GGLFLIYFSIAAMVSQFGQSFGSIYIGR"
     atgataacag acccgcaagg gaccgttctc gcgctgtttc tggttttctg ccggatcggt        60
     ggctgtgtgc tggctcttcc gggtttttcc tcggcgcgcg tgcccgatca gctgcgcgtc       120
     ttcattgcgg gggcgctgtc gatcgccgtc atgccgttgc tctgggatac cgtctatccg       180
     gccgttcaca ccggtgccgg aacctatatc ggcctgatct tcagcgaatc gctgatcggc       240
     gtgatgtatg gcatgctggc gaggatctac acgctcggca tgcagttcgc cgcgacgatc       300
     atcgccatga tggtcggcta cacccagccg ggttccgccg acatcctcga agacacgccg       360
     gagaccagcc tttccggctt cattaccttt gccggcatga tgattctctt cattatggat       420
     ttccatcaca tcgtcttccg cgcgctgatc gattcctaca cgaccatgcc cttcggcggc       480
     ttgatgcaga tgcgcgcgac gctgatctcc tttaccgaca cgctggagca gaccacctac       540
     atcatgctgc ggctgtcgag cccgtttttg atctacggcc tgatcttcaa cgtctcgatc       600
     ggtttcatca acaagctggc gccgcagatc ccggtctact tcatctccac gccctatctg       660
     ctgatgggcg ggctcttcct gatctatttc tcgattgcgg cgatggtcag ccagttcggc       720
     cagtccttcg gctcgatcta tatcgggcga tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page