(data stored in ACNUC7421 zone)

EMBL: CP001622.PE378

CP001622.PE378       Location/Qualifiers
FT   CDS_pept        387452..387865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54690"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000766"
FT                   /protein_id="ACS54690.1"
FT                   /translation="MIEKKRSQKLKRLLSVQRHIERMAENDLAETSRQRVEVNVAMDDV
FT                   ILALGSMDPVHHAFSQNYADRFGRLTIKDQQLTGMHQIHEMRLTRERAKGDRLEEGMQE
FT                   ALEAERREADDNAVYDVIDQQFATPASSKLQKP"
     atgatcgaaa agaagcgctc ccagaagctc aagcggctgc tctcggtgca gcggcatatc        60
     gaaagaatgg ccgagaacga cctggccgaa accagccgcc agcgtgtcga ggtcaatgtg       120
     gcgatggacg acgtcatcct cgcgctcggc tcgatggacc ccgtccacca cgccttctcg       180
     cagaattacg ccgaccgatt cggcaggctc accatcaagg accagcagct gaccggcatg       240
     catcagatcc acgagatgcg gctgacgcgc gagcgcgcca agggcgaccg cctcgaagag       300
     ggcatgcagg aagccctcga ggccgagcgc cgcgaggcag atgacaacgc cgtctacgat       360
     gtcatcgatc agcaattcgc aacgccagcc tccagcaagc ttcaaaaacc atag             414
//

If you have problems or comments...

PBIL Back to PBIL home page