(data stored in ACNUC7421 zone)

EMBL: CP001622.PE379

CP001622.PE379       Location/Qualifiers
FT   CDS_pept        387898..388461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54691"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000767"
FT                   /protein_id="ACS54691.1"
FT                   /translation="MAISPPSDLVLDVVKAADPMELQAAQEKLKANRAAFAATSLAENG
FT                   KGFSNTVDVLDQVGHKSGLNNIQNRTKAEEAPESYRKFEAMVLQNFVKSMLPSESEDVY
FT                   GKGATGDIWKGMMAEQLGNVMAKGDGIGIAKQMYSEQLRRQEGKIVNASTDDDDRNTAL
FT                   SMIDDFQRKTFGTPTAEAKTDRTG"
     gtggctattt cgccccccag tgatctggtc ctggacgttg tcaaagctgc cgaccccatg        60
     gagcttcagg cagcccagga aaagttgaag gcaaatcgtg cggcctttgc cgcaacgagc       120
     ctcgccgaga atggcaaggg cttctccaat acggtcgacg ttctcgatca agtcggccac       180
     aagagtggcc tcaacaacat tcagaaccgc accaaggccg aggaagctcc ggaaagctac       240
     cggaagttcg aggccatggt cctgcagaat ttcgtcaagt ccatgctgcc gagcgaaagc       300
     gaagacgtct acggcaaggg tgcgaccggc gatatctgga aaggcatgat ggccgaacag       360
     ctcggcaacg tcatggccaa gggagacggc atcggcattg ccaagcagat gtacagcgag       420
     cagctgcgcc ggcaggaagg taagatcgtc aatgcctcca ccgacgacga tgaccgcaac       480
     accgcgctca gcatgatcga cgacttccag cgcaagacct ttggcacgcc gacggccgaa       540
     gccaagaccg atagaacagg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page