(data stored in ACNUC7421 zone)

EMBL: CP001622.PE38

CP001622.PE38        Location/Qualifiers
FT   CDS_pept        complement(35409..35807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0039"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00384 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54350"
FT                   /db_xref="GOA:C6AYC6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54350.1"
FT                   /translation="MTIQSLFLVTLVVDDYDRAKAFYCDGLGFDCLQDELQPKGKRWVV
FT                   VKPRGGDGAAFLLAQAADETQRAAIGNQTGGRVGFFLKTDDFARDHAAMRAVGVRFLEE
FT                   PRHEVYGTVAVFADPYGNTFDLIQHTAA"
     atgacgatcc agtctctttt cctcgtcact ctcgtggtcg acgattacga ccgcgccaag        60
     gctttttatt gcgatggcct cggtttcgat tgccttcagg acgagctgca gccgaagggc       120
     aagcgctggg tggtggtgaa gccgaggggt ggggatggag ccgcctttct gctggcgcag       180
     gcggcagacg agacgcagcg cgcggccatc ggcaatcaga ccggcggacg tgtcggcttc       240
     tttctgaaga ccgacgattt cgcccgcgac catgccgcga tgcgggcagt cggcgttcgc       300
     tttctggaag agccgcgtca cgaggtttac ggcacggtgg cggtttttgc ggatccctac       360
     ggcaacactt tcgatttgat ccagcacacg gctgcctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page