(data stored in ACNUC7421 zone)

EMBL: CP001622.PE380

CP001622.PE380       Location/Qualifiers
FT   CDS_pept        388586..388951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H3"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00690"
FT                   /protein_id="ACS54692.1"
FT                   /translation="MEIVSNEYRIKSVLGRLEMIIDNENTRIGNDPQFDLKVSNAHKSR
FT                   CLYELSTLFRDTDPAELAAAHLDQLHGLKKKLVLNARRVEAHLEAVRAVADLLKNAVQD
FT                   ADADGTYSQEQFAARGN"
     atggaaatag tttcgaacga atacaggatc aaatccgttc tcggacgcct cgaaatgatc        60
     atcgataatg agaacacccg gatcggcaac gatccgcagt tcgatctcaa ggtctccaat       120
     gcgcataaga gccgctgcct ctacgagctg tcgacgcttt tccgcgacac cgatccggcc       180
     gagcttgccg ctgcccatct cgatcagttg cacggcttga agaagaaact ggttctcaat       240
     gcccgtcgcg tcgaggcgca tctcgaagcg gttcgcgccg tcgccgacct cctgaagaac       300
     gcggttcagg acgccgatgc cgacggcacc tattcccagg aacaattcgc cgcgcgtgga       360
     aactga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page