(data stored in ACNUC7421 zone)

EMBL: CP001622.PE381

CP001622.PE381       Location/Qualifiers
FT   CDS_pept        388951..389490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54693"
FT                   /db_xref="GOA:C6B1H4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00691"
FT                   /protein_id="ACS54693.1"
FT                   /translation="MIKLVLTGVWVCAITLASVYFSVYLATAPAPAATDSKQSALELVK
FT                   GETITVPIIGNGAITGYFLGRVSFMMNKDMLKGVTLPLSEMTTDELFSLLVGNKMVDIA
FT                   HIKSFDPKAFREEIKKGMNERLGGEYVADVMLEQLDYLSKEEVKESSAGQPKKVGKPVK
FT                   IVETAPAAEAPAPAAH"
     atgatcaagc tcgtcctcac cggtgtctgg gtttgcgcca tcaccttggc atcggtctat        60
     ttctcggtgt acctggcgac cgcgccggcg cccgcagcaa cggattccaa gcagagcgct       120
     cttgaactgg tgaagggcga aacgatcacg gtgccgatca tcggcaacgg tgcgatcacc       180
     ggttacttcc tcggccgcgt ttcgttcatg atgaacaagg acatgctgaa aggcgtgacg       240
     ttgccgctga gcgagatgac gacggacgag cttttcagtc tgctcgtcgg caataagatg       300
     gtcgatatcg cccacatcaa atccttcgat ccgaaggcct tccgcgagga gatcaagaag       360
     ggcatgaacg agcgcctcgg cggcgaatac gtcgccgacg tgatgctgga gcagctcgac       420
     tatctctcca aggaagaggt caaggaaagc tccgccggtc agccgaagaa ggtgggcaaa       480
     cccgtcaaga tcgtcgagac cgcaccggcc gccgaagcac cggcgccagc tgcccactaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page