(data stored in ACNUC7421 zone)

EMBL: CP001622.PE382

CP001622.PE382       Location/Qualifiers
FT   CDS_pept        389782..390621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0383"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   rec:RHECIAT_CH0000770 N-acetyl mannosamine transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54694"
FT                   /db_xref="GOA:C6B1H5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H5"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACS54694.1"
FT                   /translation="MNLIANFAVLASRRTIFDLPVCDLGWDDALVFINELASIPVGQTV
FT                   VCFVNAHNMLTALRDDEYYRIMSHNLVLPDGIGLNIASQIAHGSPFPANLNGTDFVPAF
FT                   LTFMEAPRRIGLIGGERSVVEAAAENFRRHTPWHEFVVVSDGYFDKVDPTDVIEELERQ
FT                   KVDILIVGMGTPLQEKWVHDHIRADHARLVLTVGALFDFVSGAVPRAPRTVRMMRLEWA
FT                   YRLLQEPTRLWRRYIIGIPVFLFHVLRYRFRRRERILSHPEEHGSALQPRSDHKKAS"
     atgaatctga ttgcaaactt cgcggtgctc gcatcgcggc ggacgatctt cgatctgccg        60
     gtctgcgatc tcggctggga cgatgccctc gttttcatca acgagctggc ctctattccc       120
     gtcggccaga ccgtggtttg cttcgtcaac gcccacaaca tgctgaccgc gctgcgcgac       180
     gacgagtatt accggatcat gtcgcacaat ctggtgctgc ctgatggtat cggcctcaac       240
     atcgcatcgc agatcgccca tggttcgccg tttcccgcca atctgaacgg caccgatttc       300
     gtgccggcct tcctcacctt catggaggcc ccgcgccgca tcggcctcat cggcggtgag       360
     cgttcggtcg tcgaggcagc ggcggaaaat ttccgcaggc acacgccctg gcacgaattc       420
     gtcgtcgttt ccgacggtta cttcgacaag gtcgatccca cagatgtcat cgaggaactc       480
     gagcgccaga aggtcgatat cctgatcgtc ggtatgggga cgccgctgca ggaaaaatgg       540
     gttcacgatc atattcgcgc cgatcatgca cgcctggtgc tgacggtggg cgctctcttc       600
     gactttgtct ccggcgccgt cccacgcgcg ccgaggacgg tgcggatgat gcgcctggaa       660
     tgggcctatc gcctgctgca ggagccgacg cgcctctggc gccgttacat catcggcatc       720
     ccggtgtttc tcttccatgt cctgcgctac cgcttccgcc ggcgcgaaag gatcctcagc       780
     catccggaag agcacggcag cgcgctgcag ccgcggtcgg atcataagaa ggcgagctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page