(data stored in ACNUC7421 zone)

EMBL: CP001622.PE383

CP001622.PE383       Location/Qualifiers
FT   CDS_pept        390778..392550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0384"
FT                   /product="putative succinoglycan biosynthesis transport
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000771 putative succinoglycan
FT                   biosynthesis transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54695"
FT                   /db_xref="GOA:C6B1H6"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000771"
FT                   /protein_id="ACS54695.1"
FT                   /translation="MYDIRARNNFQDRVAAGPRHDDDSYGAPRSRQPDIAPPEAELLRA
FT                   IGRVLEEQRARAARTAPLVDRIETILGNRLRAANDVGHLLLQQPAGDEELSVPADEPMI
FT                   SPEPLAAVREEPAAARSVAPRRRVGGIGLVMMVAAATIVGAGLPAQMPASPALYRAEAT
FT                   LAVKSDAASRAAFTQAAAKGLLSARVVASTVAALKLDHDPEFAGASANALGVALDLLSA
FT                   TGAAADPASRAEATLKHAVEILPDAAAGTILVRATTGNSGKSMRIAAKLAEAVSAADGP
FT                   GGNVETDTALRKTYDEVKVELAAFTAKSGEGNVKVAIDLRRQIDQLDADLKAADQNILA
FT                   AKAQTDRLKAAKLAEVLDGSLPSDMLSPALQDWRDKYAVAKTTLAQLSAELGPRHPRLL
FT                   QQQAETDGLKENMGKELTRLAQTANLAAKAAVDARKGLNDRRNTLIAQSRDTGVDLSRL
FT                   TELSEKANAARSRLEEATSTAVETAADGRIVLLKPALATAVSGSDGLTGRSLAGAAAGL
FT                   AIGLAAAFLLRLRRPVADPAREKMPVLRPQAALPSMPAQAPAPVDEMELLRSEISGLRD
FT                   RLRVHALEARQPLR"
     atgtacgata tcagggccag aaacaacttc caggatcgcg tagccgcagg gccgcgccac        60
     gatgacgatt cctatggggc accccggtct cgccagcctg atatcgcgcc gcccgaggcc       120
     gaattgctgc gcgccatcgg ccgggtgctg gaggagcagc gcgccagggc ggcgcgcacc       180
     gcaccgctgg tcgaccgcat cgaaaccatc ctcggcaacc gcctccgggc cgccaacgac       240
     gtcggccatc tgcttcttca gcagccggcg ggcgacgaag agctgagcgt tccggccgac       300
     gagccgatga tctcacccga accgttggca gcggtccgtg aagaacccgc ggcggcccgg       360
     tcggtcgcac cgcgccgccg cgtgggcggc attggtcttg tgatgatggt ggccgccgcg       420
     acgatcgtcg gcgcgggctt gccggcgcag atgccggctt cgccggccct ctaccgtgcc       480
     gaggcgacgc ttgcggtgaa gagcgatgcc gcaagccgcg ctgccttcac ccaggccgcg       540
     gcgaaagggc tgctgtcggc gcgggtggtt gcttcgacgg tggccgccct gaaactcgat       600
     cacgaccccg aatttgccgg cgccagtgcc aatgcgctcg gcgtcgcgct cgatctcctc       660
     tcggcgaccg gcgctgctgc cgatccggcc tcgcgcgccg aggcgacgct gaaacatgcg       720
     gtcgagatac tgcccgatgc cgccgccggc accatcctcg tcagggcgac gaccggtaat       780
     agcggcaaat ccatgcgcat cgccgcaaag cttgccgaag cggtgtccgc agcagacgga       840
     cccggcggca acgtcgagac cgataccgcc ttgcgcaaaa cctatgacga ggtgaaagtg       900
     gagcttgccg ccttcacggc gaagagcggc gagggcaacg tcaaggtggc gatcgatctt       960
     cgccgccaga tcgaccagct cgatgccgat ctgaaagcgg ccgaccagaa catccttgcc      1020
     gccaaggcgc agaccgaccg gctcaaagcc gcaaaacttg ccgaagtgct cgacggttcg      1080
     ctcccctccg atatgctttc gccggcgctg caggactggc gtgacaaata tgccgtcgcc      1140
     aaaacgacgc ttgcgcagct ttcggccgag ctcggcccgc gccatccgcg cctcttgcag      1200
     cagcaggccg aaaccgacgg tctgaaggag aatatgggca aggagctgac ccgtcttgcc      1260
     cagactgcca acctcgccgc caaagccgcc gtcgatgcgc gcaagggcct gaacgatcgc      1320
     cgcaacacgc tgatcgccca gagccgggac accggcgtcg atttgtcacg cctgaccgag      1380
     ctcagcgaaa aggcgaatgc cgcccgctcg cgcctcgaag aggcgacgtc cacagcggtg      1440
     gaaacggccg ccgacggtcg tatcgttctc ctgaagccag cattggcaac cgcagtatcg      1500
     ggaagcgatg gcctgaccgg ccgctcgctg gccggtgccg cagcgggcct tgcgataggc      1560
     cttgccgcgg ctttcttgct ccggctgcgg aggcccgtcg ccgatcccgc aagggaaaaa      1620
     atgccagtac ttcggccgca ggccgcactg ccgtcgatgc ccgcgcaggc ccccgcaccg      1680
     gtcgacgaga tggagctgct gcgctccgag atctccggcc tgcgcgaccg gcttcgtgtt      1740
     catgcgctcg aagcgcggca gccgctacgc tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page