(data stored in ACNUC7421 zone)

EMBL: CP001622.PE384

CP001622.PE384       Location/Qualifiers
FT   CDS_pept        392669..393568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0385"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: rec:RHECIAT_CH0000772 folD1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54696"
FT                   /db_xref="GOA:C6B1H7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H7"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ACS54696.1"
FT                   /translation="MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPA
FT                   SHAYVGSKGRMAKECGFKSVQHTLPAETKQEDLAALVASLNADPSIHGILVQLPLPKPL
FT                   DSEAIIQSILPEKDVDGLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLN
FT                   AVVIGRSNLFGKPMAQLLLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADW
FT                   VKPGATVIDVGINRVAAPERGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRTAGQTPPQF"
     gtgacgacag taatcgacgg aaagaacgta gctgcatcgg tcattcagac ggtcaagagt        60
     gcgacggcgg cgctggaaaa gagcagcggc gtcaccaccg gtcttgcggt tgtcatcgtt       120
     ggcgacgatc cggcaagcca cgcctatgtc ggctccaagg gccgcatggc caaggagtgc       180
     ggcttcaagt ccgttcagca cacgctgccg gccgagacga agcaggagga tctggcagcc       240
     ctcgtcgcca gcctcaacgc cgatccgtcg atccacggca ttctggtgca gctgcccctg       300
     ccgaagccgc tcgacagcga ggcgatcatc cagtcgatcc tgccggaaaa ggatgtcgac       360
     ggtctgagcg tcgtcaatgc cggcaagctc gccaccggcg atctgaagac cggacttgtc       420
     tcctgcaccc cggccggcgc catggtcttc gtccgccgca cccatggcga ggatctctcc       480
     ggcctcaacg ccgtcgtcat cggtcgctcc aacctgttcg gcaagccgat ggcgcaattg       540
     ctgctcaacg ccaatgcgac ggtgacgatc gctcattcca ggaccaagaa tctcgccgag       600
     gtctgccgca acgccgatat cctggtggcc gccgtcggcc ggccggagat ggtcagggcc       660
     gattgggtca agcccggtgc gacggtcatc gacgtcggca tcaatcgggt ggcagccccc       720
     gaaagaggcg agggcaagac ccggctcgtc ggtgacgtcg ccttcgagga ggtttcggcg       780
     gtcgccagca ccataacccc ggttcccggc ggcgtcgggc cgatgaccat tgccatgctg       840
     atggccaata cggtcattgc cgcccatcgc accgcagggc agacaccgcc gcagttttga       900
//

If you have problems or comments...

PBIL Back to PBIL home page