(data stored in ACNUC7421 zone)

EMBL: CP001622.PE385

CP001622.PE385       Location/Qualifiers
FT   CDS_pept        complement(393619..394644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0386"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: rec:RHECIAT_CH0000773 transcriptional regulator
FT                   protein, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54697"
FT                   /db_xref="GOA:C6B1H8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54697.1"
FT                   /translation="MNLKQLSELLGLSQTTVSRALNGYPEVNEATRERVLQAVKETGYR
FT                   PNKAAQRLATGKAGSIGLVMPTAPGHQSDVHFGEFLAGLGEEAVRHDFHFVIMPADPDD
FT                   EVAALRRLAISGNVDALFVAYMRGHDPRLAMLKSLSMPYVVHGRSFGSEPDYPYLDIDN
FT                   EGAFYDATRLLLQLGHTRFALMNGPMHLDFAIRRKNGVVAALAERGLALEEGCMSHALM
FT                   TDEQGLLAMEHFLQLPERPTAILCSSTVLALGAIRAVNQAGLRLGEDISLIAHDDVLPL
FT                   LKPESFSVPLTTTRSSLRAAGVRIAQRLIGTVKQAGPFPDQELWKTELIVRASTGPVPQ
FT                   A"
     gtgaatctca aacagctatc ggaattgctg gggctgtctc agacgacggt gagccgagcg        60
     ctcaacggct atcccgaggt caacgaggcg acccgggagc gcgtgcttca ggctgtcaag       120
     gaaaccgggt accgcccgaa caaggcggcg caacggcttg cgaccggcaa ggcaggctcg       180
     atcggcctcg tcatgccgac ggcgcccggc caccagtccg acgttcattt cggcgaattc       240
     ctggcagggc tgggcgaaga ggccgtgcgc cacgacttcc acttcgtgat catgccggcc       300
     gacccggatg acgaggtggc ggcgctgcgc cgccttgcga tcagcggcaa tgtcgatgcc       360
     ctgttcgtcg cctatatgcg cggccacgat ccacggctcg ccatgttgaa atcgctctcg       420
     atgccctatg tcgtgcacgg ccggtccttc ggttcggagc cggactatcc ctatctcgac       480
     atcgacaatg aaggcgcctt ctacgacgcg acgcggctct tgctacagct cggccatacg       540
     cgctttgcgc tgatgaacgg accgatgcat ctcgatttcg ccatccgcag gaagaacggt       600
     gtcgtcgccg cccttgccga gcgcgggctt gcgctcgagg agggttgcat gagccacgcg       660
     ctgatgacgg acgaacaagg cctgctggca atggaacact tcctgcaatt gccggagcga       720
     ccgacggcga tcctctgctc cagcacggtg ctggcgctcg gcgcgatccg cgcggtcaac       780
     caggccggat tgcggctcgg cgaggatatc tcgctgatcg cccatgacga cgtactgccg       840
     ctgctgaaac cggaaagctt ttccgtgccg ctgacgacga cccgctcttc actgcgggcg       900
     gcgggcgttc gcatcgcgca gcggctgatc ggcacggtaa agcaggcggg ccccttcccc       960
     gaccaggagc tctggaagac cgagctgatc gtcagggcct cgaccggtcc tgttccccag      1020
     gcctag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page