(data stored in ACNUC7421 zone)

EMBL: CP001622.PE386

CP001622.PE386       Location/Qualifiers
FT   CDS_pept        394953..396314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0387"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_CH00696 alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54698"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54698.1"
FT                   /translation="MKKSFLMGVAVAALFAGAASAADLKFAPGQDSKFNWKSYDEFKAA
FT                   HADLKGQPLTIFGPWRGEDEAFFMSVLAYFTEATGIDAKYSSSENYEQQIVIDTQAGSP
FT                   PNIAVLPQPGLLADLASKGFLTPLGDDNSKWIKDNYGAGDSWVGYGTYKGKDGKEAFYA
FT                   FPYKADVKSLVWYVPENFEEAGYKIPTTMEELHALTDQIVKDGGVPWCIGLGSGGATGW
FT                   PATDWVEDIMLRMQPPEAYDKWTTNELKFTDPAVVAAIDEFGKFAKNAKYVDGGVAAVA
FT                   STDFRDSPKGLFAVPPKCYMHHQASFIPSFFPEGTKLGQDADFFYMPTFASHPELGKPV
FT                   LGAGTLVSIAKDSKTARAFIDFLKTPIAHEVWMAQSSFLTPYKGVSTEAYANPQMKKEG
FT                   DILTSATTFRFDGSDLMPGKIGAGAFWTGMVDFVGGKSAEEAAGEIQSAWDGIK"
     atgaaaaagt catttttgat gggcgttgcc gtggcagcgc tttttgccgg tgctgcgtcc        60
     gcggccgatt tgaaatttgc cccggggcag gattccaagt tcaactggaa gagctatgac       120
     gagttcaagg ctgcgcatgc cgatctgaag ggtcagccgc tgacgatctt cgggccgtgg       180
     cgcggcgagg acgaggcgtt cttcatgagc gtgcttgcct atttcaccga agccaccggc       240
     atcgatgcca aatactcgtc ttccgaaaac tacgaacagc agatcgttat cgacacgcag       300
     gcgggctcgc cgccgaacat tgccgttctg ccgcagcccg gcctcctggc cgatctcgcc       360
     agcaagggct tcctgacgcc gctcggcgat gacaactcca agtggatcaa ggacaattac       420
     ggcgccggcg acagctgggt cggttacggt acctacaagg gcaaggacgg caaggaagcc       480
     ttctacgcct tcccgtataa ggccgacgta aaatcgctgg tctggtacgt gccggagaat       540
     ttcgaggaag ccggttacaa gatcccgacg accatggaag aactgcatgc cctgaccgac       600
     cagatcgtca aggacggcgg cgttccctgg tgcatcggac tcggttccgg cggcgccacc       660
     ggctggccgg cgaccgactg ggtcgaggac atcatgctgc gcatgcagcc gccggaagcc       720
     tacgacaagt ggacgaccaa cgagctgaag ttcaccgatc cggcggtcgt tgccgcgatc       780
     gacgagtttg gcaagttcgc caagaacgcg aaatacgtcg atggcggcgt cgcagccgtg       840
     gcctcgaccg atttccgcga cagcccgaag ggcctcttcg cggttccgcc gaagtgctac       900
     atgcaccatc aggcctcgtt catcccgtcc ttcttccctg aaggcacgaa gctcggtcag       960
     gatgccgact tcttctacat gccgaccttt gcgtcgcatc ccgaactcgg caagccggtt      1020
     ctcggcgccg gcacgctcgt ctcgatcgcc aaggactcga agacggcccg cgccttcatc      1080
     gacttcctga agaccccgat cgcccatgag gtctggatgg cgcagtcgag cttcctgacg      1140
     ccgtataagg gcgtcagcac cgaggcctat gccaacccgc agatgaagaa ggaaggcgat      1200
     atcctgacct cggccaccac cttccgcttc gacggttccg acctgatgcc gggcaagatc      1260
     ggcgccggcg ccttctggac tggcatggtc gatttcgtcg gcggcaagtc cgctgaagag      1320
     gccgctggcg aaatccagag cgcctgggac ggcatcaagt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page